(data stored in ACNUC9306 zone)

EMBL: BC002626

ID   BC002626; SV 2; linear; mRNA; STD; HUM; 1213 BP.
XX
AC   BC002626;
XX
DT   07-MAY-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens radixin, mRNA (cDNA clone IMAGE:3607251), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1213
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1213
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0d012db3e9c777a35a5ad6b51e269dc1.
XX
CC   On Aug 20, 2003 this sequence version replaced gi:13937643.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 12 Row: a Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 62244047.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1213
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_44"
FT                   /clone="IMAGE:3607251"
FT                   /tissue_type="Uterus, endometrium adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1213
FT                   /gene="RDX"
FT                   /note="synonym: DFNB24"
FT   misc_difference 32
FT                   /gene="RDX"
FT                   /note="'C' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   CDS_pept        195..>1213
FT                   /codon_start=1
FT                   /gene="RDX"
FT                   /product="RDX protein"
FT                   /db_xref="GOA:Q6PKD3"
FT                   /db_xref="H-InvDB:HIT000086148.13"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PKD3"
FT                   /protein_id="AAH02626.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFF
FT                   GLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL
FT                   QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKL
FT                   TKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
FT                   LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLEKKKKKKKKKKKKKKK"
FT   misc_difference 1169..1213
FT                   /gene="RDX"
FT                   /note="polyA tail: 45 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1213 BP; 439 A; 226 C; 269 G; 279 T; 0 other;
     cggtggcggc ggcgcctctc gtctcccgcg gcccagcgct cgcaccaccg cttctccctc        60
     cctgtcgcag ccgcgccgcc gcgcagcgcc ccagccacac gccggcgggc agaagccgcc       120
     cgctctccgg aaagtgataa cagaattcat tgaagtggag aatttttaaa gaaggtaaca       180
     aaaagagaaa gaaaatgccg aaaccaatca acgtaagagt aactacaatg gatgctgagc       240
     tggaatttgc cattcagccc aatacaactg gcaaacaact ttttgaccag gtggtgaaaa       300
     cagttggttt gcgtgaggtc tggttttttg ggctgcagta tgtagacagc aaaggttatt       360
     ctacatggct taaactaaat aaaaaggtaa cacagcagga tgttaaaaaa gagaatcctt       420
     tacagttcaa gtttagagct aaattctttc ctgaagatgt ttctgaggaa ttaattcaag       480
     aaataaccca gagactcttc ttcttgcaag ttaaagaagc catcttaaat gatgagatat       540
     attgcccgcc agaaactgca gttcttttgg cttcctatgc tgtccaagcc aagtatggag       600
     attacaataa agagattcat aagccaggct acctggctaa tgatagactc ctaccccagc       660
     gtgtattgga acaacacaaa ctaacaaaag aacagtggga agaaagaata cagaactggc       720
     atgaagaaca tagaggaatg ttaagggagg attctatgat ggaatacctg aagattgcac       780
     aagatctaga aatgtatgga gtcaactatt ttgaaataaa aaataaaaaa ggaactgaat       840
     tgtggctagg tgttgatgct ttgggtctga atatttatga gcatgacgac aagttaacac       900
     ctaaaattgg ttttccctgg agtgaaatca gaaatatttc atttaatgac aaaaaatttg       960
     ttataaagcc aatcgacaaa aaggcacctg attttgtgtt ttatgcacct cgtctgagaa      1020
     tcaataagcg gattttggcc ttatgtatgg gaaaccatga actatacatg cgaagaagga      1080
     agcctgatac tattgaagta caacagatga aggctcaggc tagggaggag aaacatcaga      1140
     agcagttgga aagggcacaa ttagagaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1200
     aaaaaaaaaa aaa                                                         1213
//

If you have problems or comments...

PBIL Back to PBIL home page