(data stored in ACNUC1829 zone)

EMBL: BC003482

ID   BC003482; SV 1; linear; mRNA; STD; MUS; 1252 BP.
XX
AC   BC003482;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus tetraspanin 4, mRNA (cDNA clone MGC:6308 IMAGE:2811065),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1252
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1252
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 19ca6d3f6cdff15d58c059b5e2d350b6.
DR   Ensembl-Gn; ENSMUSG00000025511; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033217; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032263; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032905; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033010; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033043; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032373; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117634; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087662; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087382; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087226; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086282; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: b Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 16716364.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1252
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:6308 IMAGE:2811065"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1252
FT                   /gene="Tspan4"
FT                   /note="synonyms: Tspan-4, NAG-2"
FT   CDS_pept        60..776
FT                   /codon_start=1
FT                   /gene="Tspan4"
FT                   /product="Tspan4 protein"
FT                   /db_xref="GOA:Q9DCK3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCK3"
FT                   /protein_id="AAH03482.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
FT   misc_difference 79
FT                   /gene="Tspan4"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'Q' in cDNA, 'R' in the mouse genome."
FT   misc_difference 84
FT                   /gene="Tspan4"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'V' in cDNA, 'I' in the mouse genome."
FT   misc_difference 110
FT                   /gene="Tspan4"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1238..1252
FT                   /gene="Tspan4"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1252 BP; 265 A; 337 C; 347 G; 303 T; 0 other;
     atcaggctca agatctggac tgaagactgc tggtggccag agagctgaag cgctgcagca        60
     tggcgcgcgg ctgcctccag ggcgtcaagt acctcatgtt cgccttcaat ctgctcttct       120
     ggctgggtgg ctgtggtgtc ctgggtgttg gcatctggtt ggctgccaca cagggaaact       180
     ttgccacctt atcatcctca tttccatcct tgtcggctgc caacctgctc atcgtcaccg       240
     ggaccttcgt catggccatc ggcttcgtgg gctgcattgg ggccctcaag gagaacaagt       300
     gcctactgct cactttcttt gtgctgctgc tgctagtgtt cctgctggaa gccaccattg       360
     ctgtgctctt ctttgcctac agtgacaaga ttgacagtta tgcccaacaa gacctgaaga       420
     agggcctgca tctgtatggc acacagggca acgtgggcct caccaatgcc tggagcatca       480
     tccagactga tttccgatgc tgtggagttt ccaattacac tgattggttt gaggtataca       540
     atgccactcg tgtgcctgac tcctgctgtc tggagttcag tgatagctgt gggttacatg       600
     aacctggtac ctggtggaag tcgccctgtt atgagacagt gaaggcctgg ctccaggaga       660
     acctgctagc tgtgggcatc tttggactgt gcacggcact ggtgcagatt ctgggcctca       720
     ccttcgctat gaccatgtac tgccaggtgg taaaggcgga cacctactgt gcataggtct       780
     cacagcctct gcttctctgc caaaggaccc gcccacggga aggaagatgt ccaaacccgc       840
     tccccctgca ggactggtgt tctgctgaat gcagggggaa gagctggagg ccagagcacc       900
     cagcatccat ccctgcacct gagggcactc tgcttgggtg gcagcagaca ccagactata       960
     gagttggtgc caaatggcac ccagggctaa gggcccaggg aactttgaca ctttttatat      1020
     ccatatatac cttccagtgt tcacacagga tggggttccc agccttgcat ggttgctagg      1080
     ttgggggcag gcccagtctg ctcaaggccc acgatgatct tggtgctcca ggcagggcca      1140
     ggtcccatga tccacattcc atgacagtgt cgtggttcca gatgcatctt aataaagtgt      1200
     gtgagcagac tgtgggtctt gccaacacac aaaggttaaa aaaaaaaaaa aa              1252
//

If you have problems or comments...

PBIL Back to PBIL home page