(data stored in ACNUC13479 zone)

EMBL: BC003798

ID   BC003798; SV 1; linear; mRNA; STD; MUS; 1699 BP.
XX
AC   BC003798;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus signal recognition particle receptor, B subunit, mRNA (cDNA
DE   clone MGC:6065 IMAGE:3490766), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1699
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1699
RA   Strausberg R.;
RT   ;
RL   Submitted (28-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 330125bb5618952c1e020ec4931fbd0c.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 8 Row: o Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678136.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1699
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:6065 IMAGE:3490766"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1699
FT                   /gene="Srprb"
FT   CDS_pept        28..837
FT                   /codon_start=1
FT                   /gene="Srprb"
FT                   /product="Srprb protein"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="AAH03798.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
FT   misc_feature    190..648
FT                   /gene="Srprb"
FT                   /note="Arf; Region: ADP-ribosylation factor family"
XX
SQ   Sequence 1699 BP; 427 A; 419 C; 450 G; 403 T; 0 other;
     ggcccgggaa gactacacac ctctttcatg gcttcggcga acacccggcg agttggcgat        60
     ggcgccggtg gcgccttcca gccttacctc gactccttac gacaggagct gcagcagagg       120
     gatccgacgc tgctctccgt ggcggtggct ctcctggcgg tgctgctgac gctggtgttc       180
     tggaagttca tctggagccg aaagagcagt cagagagctg ttctcttcgt tggtctctgt       240
     gactctggga aaacgttgct gtttgtcagg ttgctaactg gccagtacag agacacacag       300
     acttccatta ccgatagttc tgccatatac aaagtcaaca ataacagggg taacagcctg       360
     actctgatcg acctccccgg gcatgagagc ttgaggtttc agctcttaga tcgctttaag       420
     tcttcagcta gggctgtggt gtttgtggtg gacagtgcgg cgttccagcg ggaggtgaaa       480
     gatgtggccg aatttctgta ccaggtcctc atcgacagca tggctctgaa gaactcaccg       540
     tccttattaa tagcctgcaa taagcaagat atcgcaatgg caaaatcagc gaagttgatc       600
     cagcagcagc ttgagaagga gctcaacacc ttacgagtca cccggtccgc ggctcccagc       660
     acactggaca gttccagcac cgcacctgct cagttgggga agaaaggcaa agaatttgaa       720
     ttttcccagt tgccactcaa agtggagttc ctggagtgta gtgccaaggg tggacgaggg       780
     gacactggct ctgctgacat ccaggacttg gagaagtggc tggccaagat tgcctgagga       840
     gcatcgctgg ccacaagcgt tggtcatgtg agactgaccc tgcagtttga gaaagggcgg       900
     tggtggtgtg gactgataaa gagggggcat gtcgttgaag catttcttga gttcttgaaa       960
     cagttgtacc acccccaccc ccgtcagctc ctttctcagc tagtccttct ttcttaattc      1020
     ccatattctt tctccctttg ctaggtgtta ggtgtagcat catgttagtg tgagacataa      1080
     cagagagggc atcgctttga gagtagggtc gcatctgaga agtccttgtc tcctgcctct      1140
     gcgttggtcc cttttcctgg gaccagatct gcctgcttgt ggaagaagtg aacttgcagt      1200
     tgcccctggt gtaggcataa tacagtgtca gttcttagtg gagtctgggg tgtgaaggtc      1260
     gacagtgaag acagcttcaa agccacaggc acagctgaca gtgtgtcctt cacgggctca      1320
     gtgaccatcc cacaccaccc taggttcaaa agctgccgca accccgaaga gtcaccctca      1380
     caaggtggct ctaggagcca aatccccaga cactcctggg ttctagaggc tccactgggg      1440
     agagcaggga gacagcacac cgctgcctcg ggcgtgcgtg agcccaggct gtcccctgtg      1500
     ctacttgatc agctcctgtt gtgtcacccc agctagagtg ctatggaaca atacaaactg      1560
     aagatgtcca ctgtgcattt taaatacata tttattcatg atgctttaaa aaatgttacc      1620
     tttttaaagt gatgctgtct tcaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1680
     aaaaaaaaaa aaaaaaaaa                                                   1699
//

If you have problems or comments...

PBIL Back to PBIL home page