(data stored in ACNUC1829 zone)

EMBL: BC005246

ID   BC005246; SV 1; linear; mRNA; STD; HUM; 1159 BP.
XX
AC   BC005246;
XX
DT   04-APR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Homo sapiens tetraspanin 8, mRNA (cDNA clone MGC:12279 IMAGE:3934330),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1159
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1159
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-MAR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5e62ef221384df450e7472bcb25fed62.
DR   Ensembl-Gn; ENSG00000127324; homo_sapiens.
DR   Ensembl-Tr; ENST00000247829; homo_sapiens.
DR   Ensembl-Tr; ENST00000393330; homo_sapiens.
DR   Ensembl-Tr; ENST00000546561; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: CLONTECH
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 16 Row: l Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21265107.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1159
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_76"
FT                   /clone="MGC:12279 IMAGE:3934330"
FT                   /tissue_type="Liver"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:9606"
FT   gene            1..1159
FT                   /gene="TSPAN8"
FT                   /note="synonym: CO-029"
FT   CDS_pept        180..893
FT                   /codon_start=1
FT                   /gene="TSPAN8"
FT                   /product="tetraspanin 8"
FT                   /db_xref="GOA:P19075"
FT                   /db_xref="H-InvDB:HIT000032316.15"
FT                   /db_xref="HGNC:HGNC:11855"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19075"
FT                   /protein_id="AAH05246.1"
FT                   /translation="MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRISNDSQAIFGS
FT                   EDVGSSSYVAVDILIAVGAIIMILGFLACCGAIKESRCMLLLFFIGLLLILLLQVATGI
FT                   LGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGN
FT                   NFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGIAFGLAVIEIL
FT                   GLVFSMVLYCQIGNK"
FT   misc_difference 282
FT                   /gene="TSPAN8"
FT                   /note="'A' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'I' in cDNA, 'V' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 397
FT                   /gene="TSPAN8"
FT                   /note="'C' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'A' in cDNA, 'G' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 816
FT                   /gene="TSPAN8"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'A' in cDNA, 'S' in the human genome."
FT   misc_difference 911
FT                   /gene="TSPAN8"
FT                   /note="'G' in cDNA is 'C' in the human genome."
FT   misc_difference 1129..1159
FT                   /gene="TSPAN8"
FT                   /note="polyA tail: 31 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1159 BP; 357 A; 199 C; 250 G; 353 T; 0 other;
     agtgccccag gagctatgac aagcaaagga acatacttgc ctggagatag cctttgcgat        60
     atttaaatgt ccgtggatac agaaatctct gcaggcaagt tgctccagag catattgcag       120
     gacaagcctg taacgaatag ttaaattcac ggcatctgga ttcctaatcc ttttccgaaa       180
     tggcaggtgt gagtgcctgt ataaaatatt ctatgtttac cttcaacttc ttgttctggc       240
     tatgtggtat cttgatccta gcattagcaa tatgggtacg aataagcaat gactctcaag       300
     caatttttgg ttctgaagat gtaggctcta gctcctacgt tgctgtggac atattgattg       360
     ctgtaggtgc catcatcatg attctgggct tcctggcatg ctgcggtgct ataaaagaaa       420
     gtcgctgcat gcttctgttg tttttcatag gcttgcttct gatcctgctc ctgcaggtgg       480
     cgacaggtat cctaggagct gttttcaaat ctaagtctga tcgcattgtg aatgaaactc       540
     tctatgaaaa cacaaagctt ttgagcgcca caggggaaag tgaaaaacaa ttccaggaag       600
     ccataattgt gtttcaagaa gagtttaaat gctgcggttt ggtcaatgga gctgctgatt       660
     ggggaaataa ttttcaacac tatcctgaat tatgtgcctg tctagataag cagagaccat       720
     gccaaagcta taatggaaaa caagtttaca aagagacctg tatttctttc ataaaagact       780
     tcttggcaaa aaatttgatt atagttattg gaatagcatt tggactggca gttattgaga       840
     tactgggttt ggtgttttct atggtcctgt attgccagat cgggaacaaa tgaatctgtg       900
     gatgcatcaa gctatcgtca gtcaaacccc tttaaaatgt tgctttggct ttgtaaattt       960
     aaatatgtaa gtgctatata agtcaggagc agctgtcttt ttaaaatgtc tcggctagct      1020
     agaccacaga tatcttctag acatattgaa cacatttaag atttgaggga tataagggaa      1080
     aatgatatga atgtgtattt ttactcaaaa taaaagtaac tgtttacgca aaaaaaaaaa      1140
     aaaaaaaaaa aaaaaaaaa                                                   1159
//

If you have problems or comments...

PBIL Back to PBIL home page