(data stored in ACNUC9306 zone)

EMBL: BC005442

ID   BC005442; SV 1; linear; mRNA; STD; MUS; 2127 BP.
XX
AC   BC005442;
XX
DT   04-APR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus neurofibromatosis 2, mRNA (cDNA clone MGC:6102 IMAGE:3496053),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2127
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2127
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-MAR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 88c4d272d364d69ba5794e8f16fbfdc4.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 8 Row: d Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982774.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2127
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:6102 IMAGE:3496053"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2127
FT                   /gene="Nf2"
FT                   /note="synonym: merlin"
FT   CDS_pept        426..1487
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /product="Nf2 protein"
FT                   /db_xref="GOA:Q99K59"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:97307"
FT                   /db_xref="UniProtKB/TrEMBL:Q99K59"
FT                   /protein_id="AAH05442.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFLWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREERERERGRGGERE
FT                   RARMGPQNVSSLL"
FT   misc_difference 1195
FT                   /gene="Nf2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; amino acid
FT                   difference: 'L' in cDNA, 'P' in the mouse genome."
FT   misc_difference 2111..2127
FT                   /gene="Nf2"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2127 BP; 523 A; 551 C; 583 G; 470 T; 0 other;
     gcggagcgga gctggtgaca gacacgcacg cgcgtgtgcg ctcccaacta ctgcgcggcc        60
     ccgcgaccct cgggggtcgc tgagaggccc ggcgtcggcg ccgcagccgt ctaggatttc       120
     tgtccaaagg cgtccctggc gtccccagcc cgaagctcca agctcggggc tgcgcgtgct       180
     tttgccggca tctccccccg acccccccgt cgtcagagac tgtcccttaa ctcatctttc       240
     cgcacccaca gccgggtcct cgcggcccat gctggccgct ggggacccag gcagcctagg       300
     tctgtctcgg gccggccagc cggccaccat ggtggccctg aggcctgtgc agctactcca       360
     ggggggctaa gagacccaga acgcgggcct aggggtgagg ggatccaagg ccggtacctc       420
     gcgccatggc cggagccatc gcttctcgca tgagcttcag ctcactcaag aggaagcagc       480
     ccaagacatt cacggtgcgg atcgtcacca tggacgccga gatggagttc aactgcgaga       540
     tgaaatggaa ggggaaggac ctgtttgatt tggtgtgccg gacactgggg cttcgggaaa       600
     cctggttctt tggactgcag tatacaatca aggacacggt ggcctggctc aaaatggaca       660
     agaaggtgtt ggatcatgat gtttcgaagg aagaaccagt tacctttcac ttcctggcca       720
     aattttatcc tgaaaatgct gaggaggagc tagttcaaga gatcacgcaa cacttatttt       780
     tcttacaggt gaagaagcag attttggatg aaaaggtcta ctgccctccc gaggcgtccg       840
     tgctcttggc gtcatatgct gtccaggcca agtatggcga ctatgacccc tctgtgcaca       900
     agcggggatt tttagcccaa gaggaattgc tcccgaaaag ggtgataaat ctctatcaga       960
     tgactccgga aatgtgggag gagagaatta cggcttggta tgcggagcac cggggcagag      1020
     ccagggatga agctgaaatg gagtatttga agatagctca ggacctggag atgtatggtg      1080
     tgaactactt tacaatccgg aataaaaagg gcacagagtt gctgcttgga gtggatgctc      1140
     ttgggcttca tatctatgac cctgagaaca ggctgacccc caagatctcc ttcctatgga      1200
     atgaaatccg aaacatctcc tacagcgaca aggagtttac tattaaacca ctggataaga      1260
     aaattgatgt cttcaaattt aactcctcaa agcttcgtgt taataagctg attcttcagc      1320
     tatgtattgg gaaccatgac ctatttatga ggcgacggaa agctgactct ttagaagttc      1380
     agcagatgaa agcccaggcc agggaagaga gagagagaga gagggggcgg gggggagaga      1440
     gagagagagc tcgaatgggt ccccagaatg tctccagcct gctttgagcc tgtagctggg      1500
     ttcttactgg tagaaaattt tagtcaaaga gaaacatctg aagtccaaag tgaggcccaa      1560
     ccctggctct tcctagtttc aatggtttct gaagcatagg caggggtacc ctgctactga      1620
     aacagcaagt cactctcagt gcaggacact gaggccttgc tcttgcctgt ggctggtcac      1680
     aaaccctgat tgaggcagta cctgagccgc cacagcactc tgacctgagg tcactgccaa      1740
     cccctgctag acaacaccag tgggcttcac ttactgctat atcctctttt agacaggttt      1800
     ctcatgctcc catactttca aaaagcccag aggctgactc ccagcaacag tgactaaccg      1860
     ttcctgccaa cagggccaga gcctcaaagt ccctggtaca agcagccttc acagaggacc      1920
     cagactctcc taggtgcctt gaggccacgc cagtgcccat gggcttccat tcctctgtta      1980
     ctcttttcaa acagctcttc atgtgaggct cctgtcactc ctatcggggc caggacatga      2040
     agctggtttc tgggggttgg ggtgattata atttaagtga ttgttttaat aaaaactcta      2100
     agctgctata aaaaaaaaaa aaaaaaa                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page