(data stored in ACNUC1829 zone)

EMBL: BC007290

ID   BC007290; SV 1; linear; mRNA; STD; HUM; 1297 BP.
XX
AC   BC007290;
XX
DT   07-MAY-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens tetraspanin 1, mRNA (cDNA clone MGC:15665 IMAGE:3349295),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1297
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1297
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 22c6bb2797a2a13f1f5ef891c2d1cd7a.
DR   Ensembl-Gn; ENSG00000117472; homo_sapiens.
DR   Ensembl-Tr; ENST00000372003; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 22 Row: m Column: 14.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1297
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_15"
FT                   /clone="MGC:15665 IMAGE:3349295"
FT                   /tissue_type="Colon, adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1297
FT                   /gene="TSPAN1"
FT                   /note="synonyms: NET-1, TSPAN-1, 9030418M05Rik,
FT                   RP11-322N21.1"
FT   CDS_pept        128..853
FT                   /codon_start=1
FT                   /gene="TSPAN1"
FT                   /product="tetraspanin 1"
FT                   /db_xref="GOA:O60635"
FT                   /db_xref="H-InvDB:HIT000033123.17"
FT                   /db_xref="HGNC:HGNC:20657"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60635"
FT                   /protein_id="AAH07290.1"
FT                   /translation="MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGP
FT                   LSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAA
FT                   VVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPY
FT                   FKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGI
FT                   GGLELAAMIVSMYLYCNLQ"
FT   misc_difference 1279..1297
FT                   /gene="TSPAN1"
FT                   /note="polyA tail: 19 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1297 BP; 295 A; 335 C; 332 G; 335 T; 0 other;
     gtgagagcca ggcgtccctc tgcctgccca ctcagtggca acacccggga gctgttttgt        60
     cctttgtgga gcctcagcag ttccctcttt cagaactcac tgccaagagc cctgaacagg       120
     agccaccatg cagtgcttca gcttcattaa gaccatgatg atcctcttca atttgctcat       180
     ctttctgtgt ggtgcagccc tgttggcagt gggcatctgg gtgtcaatcg atggggcatc       240
     ctttctgaag atcttcgggc cactgtcgtc cagtgccatg cagtttgtca acgtgggcta       300
     cttcctcatc gcagccggcg ttgtggtctt tgctcttggt ttcctgggct gctatggtgc       360
     taagactgag agcaagtgtg ccctcgtgac gttcttcttc atcctcctcc tcatcttcat       420
     tgctgaggtt gcagctgctg tggtcgcctt ggtgtacacc acaatggctg agcacttcct       480
     gacgttgctg gtagtgcctg ccatcaagaa agattatggt tcccaggaag acttcactca       540
     agtgtggaac accaccatga aagggctcaa gtgctgtggc ttcaccaact atacggattt       600
     tgaggactca ccctacttca aagagaacag tgcctttccc ccattctgtt gcaatgacaa       660
     cgtcaccaac acagccaatg aaacctgcac caagcaaaag gctcacgacc aaaaagtaga       720
     gggttgcttc aatcagcttt tgtatgacat ccgaactaat gcagtcaccg tgggtggtgt       780
     ggcagctgga attgggggcc tcgagctggc tgccatgatt gtgtccatgt atctgtactg       840
     caatctacaa taagtccact tctgcctctg ccactactgc tgccacatgg gaactgtgaa       900
     gaggcaccct ggcaagcagc agtgattggg ggaggggaca ggatctaaca atgtcacttg       960
     ggccagaatg gacctgccct ttctgctcca gacttggggc tagataggga ccactccttt      1020
     taggcgatgc ctgactttcc ttccattggt gggtggatgg gtggggggca ttccagagcc      1080
     tctaaggtag ccagttctgt tgcccattcc cccagtctat taaacccttg atatgccccc      1140
     taggcctagt ggtgatccca gtgctctact gggggatgag agaaaggcat tttatagcct      1200
     gggcataagt gaaatcagca gagcctctgg gtggatgtgt agaaggcact tcaaaatgca      1260
     taaacctgtt acaatgttaa aaaaaaaaaa aaaaaaa                               1297
//

If you have problems or comments...

PBIL Back to PBIL home page