(data stored in ACNUC11016 zone)

EMBL: BC008813

ID   BC008813; SV 2; linear; mRNA; STD; HUM; 1884 BP.
XX
AC   BC008813;
XX
DT   08-JUN-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens annexin A8-like 2, mRNA (cDNA clone MGC:10405 IMAGE:3958020),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1884
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1884
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-MAY-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 15348386200e072395c18e9305370b38.
DR   Ensembl-Gn; ENSG00000264230; homo_sapiens.
DR   Ensembl-Tr; ENST00000619162; homo_sapiens.
DR   Ensembl-Tr; ENST00000622769; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:14250693.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 15 Row: b Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4502112.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1884
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_21"
FT                   /clone="MGC:10405 IMAGE:3958020"
FT                   /tissue_type="Placenta, choriocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1884
FT                   /gene="ANXA8L2"
FT                   /note="synonyms: ANXA8, bA145E20.2"
FT   misc_difference 43
FT                   /gene="ANXA8L2"
FT                   /note="'A' in cDNA is 'C' in the human genome."
FT   CDS_pept        177..1007
FT                   /codon_start=1
FT                   /gene="ANXA8L2"
FT                   /product="ANXA8L2 protein"
FT                   /db_xref="GOA:Q5VT79"
FT                   /db_xref="H-InvDB:HIT000033990.15"
FT                   /db_xref="HGNC:HGNC:23334"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR009115"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5VT79"
FT                   /protein_id="AAH08813.3"
FT                   /translation="MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLS
FT                   HQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQ
FT                   FGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQD
FT                   AQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRD
FT                   GTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP"
FT   misc_difference 566
FT                   /gene="ANXA8L2"
FT                   /note="'T' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 695
FT                   /gene="ANXA8L2"
FT                   /note="'G' in cDNA is 'T' in the human genome; amino acid
FT                   difference: 'K' in cDNA, 'N' in the human genome."
FT   misc_difference 962
FT                   /gene="ANXA8L2"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change."
FT   misc_difference 1525
FT                   /gene="ANXA8L2"
FT                   /note="'T' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1862..1884
FT                   /gene="ANXA8L2"
FT                   /note="polyA tail: 23 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1884 BP; 491 A; 526 C; 486 G; 381 T; 0 other;
     cgggggcgag ggggcggcag gcaggtgtag cgctgccctg ggagggcttg cacccccaca        60
     cccaagtgag cggcctgctc actcctcagc tgcaggagcc agacgtgtgg agtcccagca       120
     gaggccaacc tgtgtctctt catctccgtg agaaaggtgc ccccgaagtg aaagagatgg       180
     cctggtggaa agcctggatt gaacaggagg gtgtcacagt gaagagcagc tcccacttca       240
     acccagaccc tgatgcagag accctctaca aagccatgaa ggggatcggt gtcgggtccc       300
     aactgctcag ccaccaagca gctgccttcg ccttcccctc ctccgccctc accagtgtgt       360
     caccctgggg gcagcagggt cacttgtgct gtaaccctgc agggaccaac gagcaggcta       420
     tcatcgatgt gctcaccaag agaagcaaca cgcagcggca gcagatcgcc aagtccttca       480
     aggctcagtt cggcaaggac ctcactgaga ccttgaagtc tgagctcagt ggcaagtttg       540
     agaggctcat tgtggccctt atgtatccgc catacagata cgaagccaag gagctgcatg       600
     acgccatgaa gggcagcagg gatgatgtga gcagctttgt ggacccggca ctggccctcc       660
     aagacgcaca ggatctgtat gcggcaggcg agaagattcg tgggactgat gagatgaaat       720
     tcatcaccat cctgtgcacg cgcagtgcca ctcacctgct gagagtgaaa tgcacccaaa       780
     acctccacag ctactttgca gagagactct actatgccat gaagggagca gggacgcgtg       840
     atgggaccct gataagaaac atcgtttcaa ggagcgagat tgacttaaat cttatcaaat       900
     gtcacttcaa gaagatgtac ggcaagaccc tcagcagcat gatcatggaa gacaccagcg       960
     gcgactacaa gaacgccctg ctgagcctgg tgggcagcga cccctgaggc acagaagaac      1020
     aagagcaaag accatgaagc cagagtctcc aggactcctc actcaacctc ggccatggac      1080
     gcaggttggg tgtgaggggg gtcccagcct ttcggtcttc tatttcccta tttccagtgc      1140
     tttccagccg ggtttctgac ccagagggtg gaaccggcct ggactcctct tcccaacttc      1200
     ctccaggtca tttcccagtg tgagcacaat gccaacctta gtgtttctcc agccagacag      1260
     atgcctcagc atgaagggct tggggacttg tggatcattc cttcctccct gcaggagctt      1320
     cccaagctgg tcacagagtc tcctgggcac aggttataca gaccccagcc ccattcccat      1380
     ctactgaaac agggtctcca caagaggggc cagggaatat gggtttttaa caagcgtctt      1440
     acaaaacact tctctatcat gcagccggag agctggctgg gagccctttt gttttagaac      1500
     acacatcctt cagcagctga gaaatgaaca cgaatccatc ccaaccgaga tgccattaac      1560
     attcatctaa aaatgttagg ctctaaatgg acgaaaaatt ctctcgccat cttaataaca      1620
     aaataaacta caaattcctg acccaaggac actgtgttat aagaggcgtg ggctcccctg      1680
     gtggctgacc aggtcagctg ccctggcctt gcacccctct gcatgcagca cagaagggtg      1740
     tgaccatgcc ctcagcacca ctcttgtccc cactgaacgg caactgagac tgggtacctg      1800
     gagattctga agtgcctttg ctgtggtttt caaaataata aagatttgta ttcaactcaa      1860
     aaaaaaaaaa aaaaaaaaaa aaaa                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page