(data stored in ACNUC16935 zone)

EMBL: BC009507

ID   BC009507; SV 2; linear; mRNA; STD; HUM; 619 BP.
XX
AC   BC009507;
XX
DT   27-JUN-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens ISG15 ubiquitin-like modifier, mRNA (cDNA clone MGC:3945
DE   IMAGE:3545944), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-619
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-619
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-JUN-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0ed5ee3a1580c6f4ad4efa0ccf2059bd.
DR   Ensembl-Gn; ENSG00000187608; homo_sapiens.
DR   Ensembl-Tr; ENST00000379389; homo_sapiens.
DR   EuropePMC; PMC2647842; 19242562.
DR   EuropePMC; PMC3367918; 22693631.
XX
CC   On Oct 31, 2003 this sequence version replaced gi:14550513.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 11 Row: b Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4826773.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..619
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_15"
FT                   /clone="MGC:3945 IMAGE:3545944"
FT                   /tissue_type="Colon, adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..619
FT                   /gene="ISG15"
FT                   /note="synonyms: IFI15, UCRP"
FT   misc_difference 9
FT                   /gene="ISG15"
FT                   /note="'C' in cDNA is 'T' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   CDS_pept        42..539
FT                   /codon_start=1
FT                   /gene="ISG15"
FT                   /product="ISG15 ubiquitin-like modifier"
FT                   /db_xref="GOA:P05161"
FT                   /db_xref="H-InvDB:HIT000034413.17"
FT                   /db_xref="HGNC:HGNC:4053"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1Z2M"
FT                   /db_xref="PDB:2HJ8"
FT                   /db_xref="PDB:3PHX"
FT                   /db_xref="PDB:3PSE"
FT                   /db_xref="PDB:3R66"
FT                   /db_xref="PDB:3RT3"
FT                   /db_xref="PDB:3SDL"
FT                   /db_xref="PDB:5TL6"
FT                   /db_xref="PDB:5W8T"
FT                   /db_xref="PDB:5W8U"
FT                   /db_xref="PDB:6BI8"
FT                   /db_xref="PDB:6FFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05161"
FT                   /protein_id="AAH09507.1"
FT                   /translation="MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRL
FT                   AVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTV
FT                   AHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGG
FT                   RS"
FT   misc_difference 289
FT                   /gene="ISG15"
FT                   /note="'A' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'N' in cDNA, 'S' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 335
FT                   /gene="ISG15"
FT                   /note="'G' in cDNA is 'A' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 602..619
FT                   /gene="ISG15"
FT                   /note="polyA tail: 18 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 619 BP; 143 A; 180 C; 209 G; 87 T; 0 other;
     caggagctcg tgccgtggcc cacagcccac agcccacagc catgggctgg gacctgacgg        60
     tgaagatgct ggcgggcaac gaattccagg tgtccctgag cagctccatg tcggtgtcag       120
     agctgaaggc gcagatcacc cagaagatcg gcgtgcacgc cttccagcag cgtctggctg       180
     tccacccgag cggtgtggcg ctgcaggaca gggtccccct tgccagccag ggcctgggcc       240
     ccggcagcac ggtcctgctg gtggtggaca aatgcgacga acctctgaac atcctggtga       300
     ggaataacaa gggccgcagc agcacctacg aggtgcggct gacgcagacc gtggcccacc       360
     tgaagcagca agtgagcggg ctggagggtg tgcaggacga cctgttctgg ctgaccttcg       420
     aggggaagcc cctggaggac cagctcccgc tgggggagta cggcctcaag cccctgagca       480
     ccgtgttcat gaatctgcgc ctgcggggag gcggcacaga gcctggcggg cggagctaag       540
     ggcctccacc agcatccgag caggatcaag ggccggaaat aaaggctgtt gtaaagagaa       600
     aaaaaaaaaa aaaaaaaaa                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page