(data stored in ACNUC21429 zone)

EMBL: BC010066

ID   BC010066; SV 2; linear; mRNA; STD; HUM; 2334 BP.
XX
AC   BC010066;
XX
DT   17-JUL-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens ubiquilin 1, mRNA (cDNA clone MGC:19622 IMAGE:4110398),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2334
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2334
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3922bf367d9cd97224dde7fd31259eaa.
DR   Ensembl-Gn; ENSG00000135018; homo_sapiens.
DR   Ensembl-Tr; ENST00000257468; homo_sapiens.
DR   Ensembl-Tr; ENST00000376395; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:14714423.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 27 Row: m Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 16753204.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2334
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_17"
FT                   /clone="MGC:19622 IMAGE:4110398"
FT                   /tissue_type="Muscle, rhabdomyosarcoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..2334
FT                   /gene="UBQLN1"
FT                   /note="synonyms: DSK2, PLIC-1, XDRP1, DA41"
FT   CDS_pept        255..1940
FT                   /codon_start=1
FT                   /gene="UBQLN1"
FT                   /product="ubiquilin 1"
FT                   /db_xref="GOA:Q9UMX0"
FT                   /db_xref="H-InvDB:HIT000050528.16"
FT                   /db_xref="HGNC:HGNC:12508"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:2JY5"
FT                   /db_xref="PDB:2JY6"
FT                   /db_xref="PDB:2KLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UMX0"
FT                   /protein_id="AAH10066.1"
FT                   /translation="MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPK
FT                   EKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHL
FT                   VIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGL
FT                   NTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRN
FT                   PEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE
FT                   PMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAS
FT                   TVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPY
FT                   MRSMMQSLSQNPDLAAQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTP
FT                   GLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEV
FT                   RFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS"
FT   misc_difference 2296..2334
FT                   /gene="UBQLN1"
FT                   /note="polyA tail: 39 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 2334 BP; 665 A; 562 C; 535 G; 572 T; 0 other;
     cggatgtcgg tgtgagcgag cggcgcctga acacacggcg gctgccgagc gcctgacccg        60
     ggcctgcgcc agagcctgca ccgagctccg gggccccaca cccgctacgg tggccctgcg       120
     cccgttgcta ctgaggcggc gtgctctgca ttcttcgctg tccaggcctg ccggctctgg       180
     tgtctgctgg ctcctccttg ctcgcctgct ccctcctgct tgcctgagtc accgccgccg       240
     ccgccgccac agccatggcc gagagtggtg aaagcggcgg tcctccgggc tcccaggata       300
     gcgccgccgg agccgaaggt gctggcgccc ccgcggccgc tgcctccgcg gagcccaaaa       360
     tcatgaaagt caccgtgaag accccgaagg aaaaggagga attcgccgtg cccgagaata       420
     gctccgtcca gcagtttaag gaagaaatct ctaaacgttt taaatcacat actgaccaac       480
     ttgtgttgat atttgctgga aaaattttga aagatcaaga taccttgagt cagcatggaa       540
     ttcatgatgg acttactgtt caccttgtca ttaaaacaca aaacaggcct caggatcatt       600
     cagctcagca aacaaataca gctggaagca atgttactac atcatcaact cctaatagta       660
     actctacatc tggttctgct actagcaacc cttttggttt aggtggcctt gggggacttg       720
     caggtctgag tagcttgggt ttgaatacta ccaacttctc tgaactacag agtcagatgc       780
     agcgacaact tttgtctaac cctgaaatga tggtccagat catggaaaat ccctttgttc       840
     agagcatgct ctcaaatcct gacctgatga gacagttaat tatggccaat ccacaaatgc       900
     agcagttgat acagagaaat ccagaaatta gtcatatgtt gaataatcca gatataatga       960
     gacaaacgtt ggaacttgcc aggaatccag caatgatgca ggagatgatg aggaaccagg      1020
     accgagcttt gagcaaccta gaaagcatcc cagggggata taatgcttta aggcgcatgt      1080
     acacagatat tcaggaacca atgctgagtg ctgcacaaga gcagtttggt ggtaatccat      1140
     ttgcttcctt ggtgagcaat acatcctctg gtgaaggtag tcaaccttcc cgtacagaaa      1200
     atagagatcc actacccaat ccatgggctc cacagacttc ccagagttca tcagcttcca      1260
     gcggcactgc cagcactgtg ggtggcacta ctggtagtac tgccagtggc acttctgggc      1320
     agagtactac tgcgccaaat ttggtgcctg gagtaggagc tagtatgttc aacacaccag      1380
     gaatgcagag cttgttgcaa caaataactg aaaacccaca actgatgcaa aacatgttgt      1440
     ctgcccccta catgagaagc atgatgcagt cactaagcca gaatcctgac cttgctgcac      1500
     agatgcagaa tcctgataca ctatcagcaa tgtcaaaccc tagagcaatg caggccttgt      1560
     tacagattca gcagggttta cagacattag caacggaagc cccgggcctc atcccagggt      1620
     ttactcctgg cttgggggca ttaggaagca ctggaggctc ttcgggaact aatggatcta      1680
     acgccacacc tagtgaaaac acaagtccca cagcaggaac cactgaacct ggacatcagc      1740
     agtttattca gcagatgctg caggctcttg ctggagtaaa tcctcagcta cagaatccag      1800
     aagtcagatt tcagcaacaa ctggaacaac tcagtgcaat gggatttttg aaccgtgaag      1860
     caaacttgca agctctaata gcaacaggag gtgatatcaa tgcagctatt gaaaggttac      1920
     tgggctccca gccatcatag cagcatttct gtatcttgaa aaaatgtaat ttatttttga      1980
     taacggctct taaactttaa aatacctgct ttatttcatt ttgactcttg gaattctgtg      2040
     ctgttataaa caaacccaat atgatgcatt ttaaggtgga gtacagtaag atgtgtgggt      2100
     ttttctgtat ttttcttttc tggaacagtg ggaattaagg ctactgcatg catcacttct      2160
     gcatttattg taatttttta aaaacatcac cttttatagt tgggtgacca gattttgtcc      2220
     tgcatctgtc cagtttattt gctttttaaa cattagccta tggtagtaat ttatgtagaa      2280
     taaaagcatt aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa            2334
//

If you have problems or comments...

PBIL Back to PBIL home page