(data stored in ACNUC8465 zone)

EMBL: BC012009

ID   BC012009; SV 1; linear; mRNA; STD; HUM; 1500 BP.
XX
AC   BC012009;
XX
DT   03-AUG-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens mitogen-activated protein kinase kinase 6, mRNA (cDNA clone
DE   MGC:21331 IMAGE:4499772), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1500
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1500
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-JUL-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 22b03f055d313fe19862886d389c740b.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
DR   EuropePMC; PMC5247655; 27909054.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 28 Row: e Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 14589899.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1500
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_93"
FT                   /clone="MGC:21331 IMAGE:4499772"
FT                   /tissue_type="Bladder, transitional cell papilloma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1500
FT                   /gene="MAP2K6"
FT                   /note="synonyms: MAPKK6, MEK6, MKK6, SAPKK3"
FT   CDS_pept        199..1203
FT                   /codon_start=1
FT                   /gene="MAP2K6"
FT                   /product="mitogen-activated protein kinase kinase 6"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000035599.18"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="AAH12009.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
FT   misc_difference 1464..1500
FT                   /gene="MAP2K6"
FT                   /note="polyA tail: 37 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1500 BP; 465 A; 312 C; 341 G; 382 T; 0 other;
     cactttccag tctgttttgc aaggtgtgca tttccatctt gattccctga aagtccatct        60
     gctgcatcgg tcaagagaaa ctccacttgc atgaagattg cacgcctgca gcttgcatct       120
     ttgttgcaaa actagctaca gaagagaagc aaggcaaagt cttttgtgct cccctccccc       180
     atcaaaggaa aggggaaaat gtctcagtcg aaaggcaaga agcgaaaccc tggccttaaa       240
     attccaaaag aagcatttga acaacctcag accagttcca caccacctcg agatttagac       300
     tccaaggctt gcatttctat tggaaatcag aactttgagg tgaaggcaga tgacctggag       360
     cctataatgg aactgggacg aggtgcgtac ggggtggtgg agaagatgcg gcacgtgccc       420
     agcgggcaga tcatggcagt gaagcggatc cgagccacag taaatagcca ggaacagaaa       480
     cggctactga tggatttgga tatttccatg aggacggtgg actgtccatt cactgtcacc       540
     ttttatggcg cactgtttcg ggagggtgat gtgtggatct gcatggagct catggataca       600
     tcactagata aattctacaa acaagttatt gataaaggcc agacaattcc agaggacatc       660
     ttagggaaaa tagcagtttc tattgtaaaa gcattagaac atttacatag taagctgtct       720
     gtcattcaca gagacgtcaa gccttctaat gtactcatca atgctctcgg tcaagtgaag       780
     atgtgcgatt ttggaatcag tggctacttg gtggactctg ttgctaaaac aattgatgca       840
     ggttgcaaac catacatggc ccctgaaaga ataaacccag agctcaacca gaagggatac       900
     agtgtgaagt ctgacatttg gagtctgggc atcacgatga ttgagttggc catccttcga       960
     tttccctatg attcatgggg aactccattt cagcagctca aacaggtggt agaggagcca      1020
     tcgccacaac tcccagcaga caagttctct gcagagtttg ttgactttac ctcacagtgc      1080
     ttaaagaaga attccaaaga acggcctaca tacccagagc taatgcaaca tccatttttc      1140
     accctacatg aatccaaagg aacagatgtg gcatcttttg taaaactgat tcttggagac      1200
     taaaaagcag tggacttaat cggttgaccc tactgtggat tggtgggttt cggggtgaag      1260
     caagttcact acagcatcaa tagaaagtca tctttgagat aatttaaccc tgcctctcag      1320
     agggttttct ctcccaattt tctttttact ccccctctta agggggcctt ggaatctata      1380
     gtatagaatg aactgtctag atggatgaat tatgataaag gcttaggact tcaaaaggtg      1440
     attaaatatt taatgatgtg tcaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page