(data stored in ACNUC22857 zone)

EMBL: BC012150

ID   BC012150; SV 1; linear; mRNA; STD; HUM; 2373 BP.
XX
AC   BC012150;
XX
DT   07-AUG-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens, clone IMAGE:4558274, mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2373
RA   Strausberg R.;
RT   ;
RL   Submitted (02-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; ce46f87e830bc32e8b13f98a902dac15.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 29 Row: d Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2373
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_16"
FT                   /clone="IMAGE:4558274"
FT                   /tissue_type="Eye, retinoblastoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..1673
FT                   /codon_start=3
FT                   /product="Unknown (protein for IMAGE:4558274)"
FT                   /db_xref="GOA:Q96EL6"
FT                   /db_xref="H-InvDB:HIT000087796.13"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q96EL6"
FT                   /protein_id="AAH12150.1"
FT                   /translation="LDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLD
FT                   EPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSET
FT                   QELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPT
FT                   LLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQ
FT                   PQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSP
FT                   AVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAK
FT                   GLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
FT                   SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLA
FT                   TWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIW
FT                   ILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 2373 BP; 647 A; 567 C; 509 G; 650 T; 0 other;
     tgcttgatct aatccagacc aaagtgaatt atgtggtcca agaagcaatt gttgtcatca        60
     gggacatctt ccgcaaatac cccaacaagt atgaaagtat catcgccact ctgtgtgaga       120
     acttagactc gctggatgag ccagatgctc gagcagctat gatttggatt gtgggagaat       180
     atgctgaaag aattgacaat gcagatgagt tactagaaag cttcctggag ggttttcacg       240
     atgaaagcac ccaggtgcag ctcactctgc ttactgccat agtgaagctg tttctcaaga       300
     aaccatcaga aacacaggag ctagtccagc aggtcttgag tttggcaaca caggattctg       360
     ataatcctga ccttcgagac cggggctata tttattggcg ccttctctca actgaccctg       420
     ttacagctaa agaagtagtc ttgtctgaga agccactgat ctctgaggag acggacctta       480
     ttgagccaac tctgctggat gagctaatct gccacattgg ttctttggcc tctgtgtatc       540
     ataagcctcc caatgctttt gtggaaggaa gtcatggaat tcatcgtaaa cacttgccaa       600
     ttcatcatgg gagcactgat gcaggtgaca gccctgttgg cactaccact gcaacgaacc       660
     tggaacagcc tcaggttatc ccctctcaag gtgatcttct aggggatctt ttaaaccttg       720
     acctcggtcc cccagtcaat gtgccacagg tgtcctccat gcagatggga gcagtggatc       780
     tcctaggagg aggactagat agtctgcttg gcagtgacct tggcgggggc attggaggaa       840
     gtccggcagt gggacaatcc ttcatcccat catcggtgcc tgcaaccttt gctccttcac       900
     ctacacctgc tgtggtcagc agtggactga atgacctgtt tgaactctcc acagggatag       960
     gcatggcacc tggtggatat gtggctccta aggctgtctg gctacctgca gtaaaggcta      1020
     aaggcttgga gatttccgga acatttactc accgccaagg gcacatctat atggaaatga      1080
     acttcaccaa taaagctctg cagcacatga cagattttgc aatccagttt aacaaaaata      1140
     gctttggtgt catccccagc actcctctgg ccatccatac accactgatg ccaaaccaga      1200
     gcattgatgt ctccctgcct ctcaatacct tgggcccagt catgaagatg gaacctctga      1260
     ataacctcca ggtggctgtg aaaaacaata tcgatgtctt ctacttcagc tgcctcatcc      1320
     cactcaatgt gctttttgta gaagatggca aaatggagcg ccaggtcttc cttgcaacat      1380
     ggaaggatat tcccaatgaa aatgaacttc agtttcagat taaggaatgt catttaaatg      1440
     ctgacactgt ttccagcaag ttgcaaaaca acaatgttta tactattgcc aagaggaatg      1500
     tggaagggca ggacatgctg taccaatccc tgaagctcac taatggcatt tggattttgg      1560
     ccgaactacg tatccagcca ggaaacccca attacacgct gtcactgaag tgtagagctc      1620
     ctgaagtctc tcaatacatc tatcaggtct acgacagcat tttgaaaaac taacaagact      1680
     ggtccagtac ccttcaacca tgctgtgatc ggtgcaagtc aagaactctt aactggaaga      1740
     aattgtattg ctgcgtagaa tctgaacaca ctgaggccac ctagcaaggt agtaactagt      1800
     ctaacctgtg ctaacattag ggcacaacct gttggatagt tttagcttcc tgtgaacatt      1860
     tgtaaccact gcttcagtca cctcccacct cttgccacct gctgctgcta tctgtcctta      1920
     cttgtgggct tctccatgct gtgccaatgg ctggcttttt ctacaccctc ttttgagtgt      1980
     agtttggtat tttgtaattg agagctcatt tcaaaagcag aaaaagacaa caaatattaa      2040
     agcaaggaaa agtgtaactg aaacactgca ctttactgtt ttatactttt gtacatatga      2100
     gaaatcaagg gattagtgca accagtagaa ggcattgaaa tgactgtcat taaccacaca      2160
     gtcctggagg cagagatgca gttacctacc ctagcttttg atgggttctc ttacctgtag      2220
     tagccttatc cctggtcatt tggattttca gtttgctttt ttcttttttt cccctccaaa      2280
     ctccttttcc ttggccaagc cttcatgctt ccccctttcc atattataat ctcatttgat      2340
     tgctctgcaa aaaaaaaaaa aaaaaaaaaa aaa                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page