(data stored in ACNUC1829 zone)

EMBL: BC012236

ID   BC012236; SV 1; linear; mRNA; STD; MUS; 1584 BP.
XX
AC   BC012236;
XX
DT   09-AUG-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus CD151 antigen, mRNA (cDNA clone MGC:5773 IMAGE:3500850),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1584
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1584
RA   Strausberg R.;
RT   ;
RL   Submitted (06-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 227674af4ccca78459f18e63292f736e.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 9 Row: e Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6753333.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1584
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="CZECH II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:5773 IMAGE:3500850"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1584
FT                   /gene="Cd151"
FT                   /note="synonyms: SFA-1, PETA-3"
FT   CDS_pept        38..799
FT                   /codon_start=1
FT                   /product="Cd151 protein"
FT                   /db_xref="GOA:Q921J7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1096360"
FT                   /db_xref="UniProtKB/TrEMBL:Q921J7"
FT                   /protein_id="AAH12236.1"
FT                   /translation="MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASSTYLATAYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVTSAVDKLQQEFHCCGSNNSQD
FT                   WQDSEWIHSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   misc_feature    86..781
FT                   /note="transmembrane4; Region: Tetraspanin family"
XX
SQ   Sequence 1584 BP; 365 A; 428 C; 410 G; 381 T; 0 other;
     ctctgccata tctgggaacg ggtatgagtg gcccaggatg ggtgaattca atgagaagaa        60
     ggcaacatgt ggcacagtct gcctcaagta cctgctcttc acctacaact gctgcttctg       120
     gctggccggc ctggctgtca tggcagtggg catctggaca ctggccctca agagtgacta       180
     cattagtctg ctggcctcaa gcacttacct agccacggcc tacatcttag tggtggctgg       240
     tgttgttgtc atggtgactg gagtcctggg ctgctgtgcc actttcaagg agcgacggaa       300
     cctgttacgc ttgtacttca tcctgctcct catcatcttc ctcctggaga tcattgctgg       360
     catcctggcc tatgtctatt atcagcagct gaacacagag ctcaaggaga atctgaagga       420
     caccatggtc aagagatacc accagtcagg ccacgagggt gtgaccagtg ctgtcgacaa       480
     gctgcagcaa gagttccact gttgtggcag caacaactct caagactggc aagacagcga       540
     gtggatccac tctggtgagg cagacagccg cgtggttcct gacagctgct gtaagactat       600
     ggtagctggc tgtggtaagc gggaccatgc ctccaacatc tataaagtgg agggtggctg       660
     tatcactaag ctggagacct tcattcagga gcacctgcgg gtcattgggg cggtgggcat       720
     tggcatcgcc tgtgtgcagg tcttcggcat gatcttcacc tgctgcttgt accgaagcct       780
     caagctggaa cactactgac cacgatgatg ccaggccagg cagccagcct tgcactactg       840
     accacgatga tgccaggctg gacggccagc cttgcattat gtcccagccc cactactgaa       900
     cactactgac ttagactgct gactgccaga ggtagctacc ctcatgccat cgccatgacc       960
     ccccctggca tgccacctca ggggcatgca ccttcaagtg cctttcactg cacaccaaag      1020
     tcccaaagct cgaagcagcg tacttgcccc agcattaagg ggggcgggga gggcggctca      1080
     aatgccagtg ttgggctagg cctggctagt agaatagggt ttagattatt tgacagaagt      1140
     gcctcttatg cagactgctt ccctttgggt agctgtgatc tgcagtaagt ctggggagaa      1200
     cctgagtaca ccactacacg ttgggtaaaa gcaggtgggg cctttctggt tggattaggc      1260
     actcttcatg cctgctaccg ggaactctca gatctgcttg ccccaaacaa atggtgtaag      1320
     ctgagggaaa ctccaacccc acacttgatg atctgtcctc tccacacagg cctcttgctc      1380
     ctaacagctc agccctggcc ttttctcact attgatagca tcatgtaaat gctccatgtt      1440
     cctgtacact gtctcctttt ggagcatctc tgaatggagc atggctgttt tcatctcact      1500
     gctgtattcc agatgctgcc cacaaatgct cctgctatgt aacaggtgct caataaatgt      1560
     aaatgtataa aaaaaaaaaa aaaa                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page