(data stored in ACNUC27125 zone)

EMBL: BC012586

ID   BC012586; SV 2; linear; mRNA; STD; HUM; 1228 BP.
XX
AC   BC012586;
XX
DT   21-AUG-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens zinc finger, MYND domain containing 11, mRNA (cDNA clone
DE   IMAGE:3950009), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1228
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1228
RA   Strausberg R.;
RT   ;
RL   Submitted (15-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 01ac491840315a2fa44aeac7e6144505.
XX
CC   On Aug 25, 2003 this sequence version replaced gi:15214893.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: CLONTECH
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 19 Row: a Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 5729745.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1228
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_78"
FT                   /clone="IMAGE:3950009"
FT                   /tissue_type="Pancreas"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1228
FT                   /gene="ZMYND11"
FT                   /note="synonym: BS69"
FT   CDS_pept        141..>1228
FT                   /codon_start=1
FT                   /gene="ZMYND11"
FT                   /product="ZMYND11 protein"
FT                   /db_xref="GOA:Q6PJR5"
FT                   /db_xref="H-InvDB:HIT000087908.14"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR035505"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PJR5"
FT                   /protein_id="AAH12586.1"
FT                   /translation="MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGY
FT                   WLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPV
FT                   CRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQE
FT                   KVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCF
FT                   YLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIP
FT                   SENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSIS
FT                   STSNEQLKVTQEPKKKKKKKKK"
XX
SQ   Sequence 1228 BP; 398 A; 236 C; 305 G; 289 T; 0 other;
     gctaaagaag taaacaggtc atggcacgtt taacaaaaag acgacaggcg gatacaaaag        60
     ctatccagca tctttgggca gccattgaga ttatacggaa ccagaagcag attgccaaca       120
     ttgaccgtat tacaaagtat atgtctcgag tccacggtat gcaccctaaa gagaccaccc       180
     gtcagctgag cttagctgtg aaagatggtc ttattgtcga aactctaaca gtgggctgca       240
     aaggttcaaa agctggtatt gaacaagaag gatattggtt gccaggagat gagattgact       300
     gggaaacaga aaatcatgac tggtattgtt ttgaatgcca tttgcctgga gaggtgttga       360
     tatgtgacct gtgttttcgt gtgtatcatt ccaagtgttt gtctgatgag ttcaggctta       420
     gagacagcag tagtccctgg cagtgcccag tttgcaggag cattaagaag aagaatacaa       480
     acaaacagga gatgggcaca tacctcagat tcattgtctc ccgcatgaag gagagggcta       540
     tagatcttaa taaaaagggg aaggacaata aacacccgat gtacaggagg ctggtgcact       600
     cagctgtgga cgttcccacc attcaagaga aagtgaatga agggaaatac cgaagttatg       660
     aagagttcaa agctgatgcc caattgcttc tccacaatac cgtgattttc tatggagcag       720
     acagtgagca agctgacatt gcgaggatgc tatataaaga cacatgtcat gagctggatg       780
     aactgcagct ttgcaagaat tgcttttact tgtcaaatgc tcgtcctgac aactggttct       840
     gttatccttg tatacctaat catgagctgg tttgggctaa aatgaaaggt tttgggtttt       900
     ggccagccaa agtcatgcag aaagaagaca atcaagtcga cgttcgcttc tttggccacc       960
     accaccagag ggcctggatt ccttctgaaa acattcaaga tatcacagtc aacattcatc      1020
     ggctgcacgt gaagcgcagt atgggttgga aaaaggcctg tgatgagctg gagctgcatc      1080
     agcgtttcct acgagaaggg agattttgga aatctaagaa tgaggaccga ggtgaggaag      1140
     aggcagaatc cagtatctcc tccaccagta atgagcagct aaaggtcact caagaaccaa      1200
     aaaaaaaaaa aaaaaaaaaa aaaaaaaa                                         1228
//

If you have problems or comments...

PBIL Back to PBIL home page