(data stored in ACNUC31108 zone)

EMBL: BC013017

ID   BC013017; SV 2; linear; mRNA; STD; HUM; 872 BP.
XX
AC   BC013017;
XX
DT   24-AUG-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens CD63 molecule, mRNA (cDNA clone MGC:4528 IMAGE:3010594),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-872
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-872
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 27653b23d6bcd2a0dcbe21ec86237ef5.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
CC   On Nov 6, 2003 this sequence version replaced gi:15278205.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 10 Row: m Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328936.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..872
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_17"
FT                   /clone="MGC:4528 IMAGE:3010594"
FT                   /tissue_type="Muscle, rhabdomyosarcoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..872
FT                   /gene="CD63"
FT                   /note="synonyms: TSPAN30, LAMP-3, OMA81H, ME491"
FT   CDS_pept        42..758
FT                   /codon_start=1
FT                   /gene="CD63"
FT                   /product="CD63 molecule"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000036084.17"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="AAH13017.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
FT   misc_difference 852..872
FT                   /gene="CD63"
FT                   /note="polyA tail: 21 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 872 BP; 199 A; 185 C; 258 G; 230 T; 0 other;
     ggaacgcgca gccagccttg ggaagcccag gcccggcagc catggcggtg gaaggaggaa        60
     tgaaatgtgt gaagttcttg ctctacgtcc tcctgctggc cttttgcgcc tgtgcagtgg       120
     gactgattgc cgtgggtgtc ggggcacagc ttgtcctgag tcagaccata atccaggggg       180
     ctacccctgg ctctctgttg ccagtggtca tcatcgcagt gggtgtcttc ctcttcctgg       240
     tggcttttgt gggctgctgc ggggcctgca aggagaacta ttgtcttatg atcacgtttg       300
     ccatctttct gtctcttatc atgttggtgg aggtggccgc agccattgct ggctatgtgt       360
     ttagagataa ggtgatgtca gagtttaata acaacttccg gcagcagatg gagaattacc       420
     cgaaaaacaa ccacactgct tcgatcctgg acaggatgca ggcagatttt aagtgctgtg       480
     gggctgctaa ctacacagat tgggagaaaa tcccttccat gtcgaagaac cgagtccccg       540
     actcctgctg cattaatgtt actgtgggct gtgggattaa tttcaacgag aaggcgatcc       600
     ataaggaggg ctgtgtggag aagattgggg gctggctgag gaaaaatgtg ctggtggtag       660
     ctgcagcagc ccttggaatt gcttttgtcg aggttttggg aattgtcttt gcctgctgcc       720
     tcgtgaagag tatcagaagt ggctacgagg tgatgtaggg gtctggtctc ctcagcctcc       780
     tcatctgggg gagtggaata gtatcctcca ggtttttcaa ttaaacggat tattttttca       840
     gaccgaaaag aaaaaaaaaa aaaaaaaaaa aa                                     872
//

If you have problems or comments...

PBIL Back to PBIL home page