(data stored in ACNUC1829 zone)

EMBL: BC013302

ID   BC013302; SV 2; linear; mRNA; STD; HUM; 1532 BP.
XX
AC   BC013302;
XX
DT   30-AUG-2001 (Rel. 68, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Homo sapiens CD151 molecule (Raph blood group), mRNA (cDNA clone MGC:4431
DE   IMAGE:2958615), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1532
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1532
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 07a799ed57963f647081e2396f4660ba.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:15342062.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 10 Row: a Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328913.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1532
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_14"
FT                   /clone="MGC:4431 IMAGE:2958615"
FT                   /tissue_type="Kidney, renal cell adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1532
FT                   /gene="CD151"
FT                   /note="synonyms: TSPAN24, GP27, SFA1, PETA-3, RAPH"
FT   misc_difference 15^16
FT                   /gene="CD151"
FT                   /note="3 bases in the human genome, TGC, are not found in
FT                   cDNA. The chimpanzee genome agrees with the cDNA sequence,
FT                   suggesting that this difference is unlikely to be due to an
FT                   artifact."
FT   CDS_pept        117..878
FT                   /codon_start=1
FT                   /gene="CD151"
FT                   /product="CD151 molecule (Raph blood group)"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000036198.19"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="AAH13302.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   misc_difference 695
FT                   /gene="CD151"
FT                   /note="'A' in cDNA is 'G' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 1105
FT                   /gene="CD151"
FT                   /note="'G' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1110
FT                   /gene="CD151"
FT                   /note="'T' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1228
FT                   /gene="CD151"
FT                   /note="'T' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1320
FT                   /gene="CD151"
FT                   /note="'G' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1446
FT                   /gene="CD151"
FT                   /note="'A' in cDNA is 'T' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1516..1532
FT                   /gene="CD151"
FT                   /note="polyA tail: 17 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1532 BP; 293 A; 479 C; 450 G; 310 T; 0 other;
     cgcccccgca gctgccgccg ccgccagggc ccggactcgg acgcgtgcct agagtcctgg        60
     ggagcttctg tccacctgtc ctgcagagga gtcgtttcca gcccggctgc cccaggatgg       120
     gtgagttcaa cgagaagaag acaacatgtg gcaccgtttg cctcaagtac ctgctgttta       180
     cctacaattg ctgcttctgg ctggctggcc tggctgtcat ggcagtgggc atctggacgc       240
     tggccctcaa gagtgactac atcagcctgc tggcctcagg cacctacctg gccacagcct       300
     acatcctggt ggtggcgggc actgtcgtca tggtgactgg ggtcttgggc tgctgcgcca       360
     ccttcaagga gcgtcggaac ctgctgcgcc tgtacttcat cctgctcctc atcatctttc       420
     tgctggagat catcgctggt atcctcgcct acgcctacta ccagcagctg aacacggagc       480
     tcaaggagaa cctgaaggac accatgacca agcgctacca ccagccgggc catgaggctg       540
     tgaccagcgc tgtggaccag ctgcagcagg agttccactg ctgtggcagc aacaactcac       600
     aggactggcg agacagtgag tggatccgct cacaggaggc cggtggccgt gtggtcccag       660
     acagctgctg caagacggtg gtggctcttt gtggacagcg agaccatgcc tccaacatct       720
     acaaggtgga gggcggctgc atcaccaagt tggagacctt catccaggag cacctgaggg       780
     tcattggggc tgtggggatc ggcattgcct gtgtgcaggt ctttggcatg atcttcacgt       840
     gctgcctgta caggagtctc aagctggagc actactgacc ctgccttggg ccttgctgct       900
     gctgcaccca actactgagc tgagaccact gagtaccagg ggctgggctc cctgatgaca       960
     cccaccctgt gccatcacca taacctctgg ggaccccaac ctcagaggca gcttcaagtg      1020
     ccttttgctg cgcaccaatg cccagcaggg gaggtgaggg gggctggcgg ggcgaagttt      1080
     ggggggtgtt ttgtggggct ccccggacat actctctgcc tggtggtcag atgcaggttg      1140
     gaaggggcct tgctgagtgg cgcaaggccg agcgttccca gcagggggag aaacccttca      1200
     caccccaggc ccttcaggaa ctggggcttt gccttgcagc cacatggccc catcccagtt      1260
     ggggaagcca ggtgagctct gacccttggg cctgggcctc tgcccctccc aacccagccg      1320
     tcgtctccct cgacagcgcc cctgctgtct tccccaccgc agtcaccacc acccgaaatg      1380
     ccacgtggtc actgtgcact gccctgttca tgtgcctctg cggggcaggg ccttcctggt      1440
     tttgtacact gctgtaccca gatgcctaca accatccctg ccacatacag gtgctcaata      1500
     aacacttgta gagcaaaaaa aaaaaaaaaa aa                                    1532
//

If you have problems or comments...

PBIL Back to PBIL home page