(data stored in ACNUC31108 zone)

EMBL: BC013404

ID   BC013404; SV 2; linear; mRNA; STD; HUM; 1297 BP.
XX
AC   BC013404;
XX
DT   06-SEP-2001 (Rel. 69, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens tetraspanin 1, mRNA (cDNA clone MGC:4439 IMAGE:2959379),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1297
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1297
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-AUG-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1e1c95dea2bbbe805e95d4a59199d274.
DR   Ensembl-Gn; ENSG00000117472; homo_sapiens.
DR   Ensembl-Tr; ENST00000372003; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:15426570.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 10 Row: m Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21264577.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1297
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_15"
FT                   /clone="MGC:4439 IMAGE:2959379"
FT                   /tissue_type="Colon, adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1297
FT                   /gene="TSPAN1"
FT                   /note="synonyms: NET-1, TSPAN-1, 9030418M05Rik,
FT                   RP11-322N21.1"
FT   CDS_pept        126..851
FT                   /codon_start=1
FT                   /gene="TSPAN1"
FT                   /product="tetraspanin 1"
FT                   /db_xref="GOA:O60635"
FT                   /db_xref="H-InvDB:HIT000036253.15"
FT                   /db_xref="HGNC:HGNC:20657"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60635"
FT                   /protein_id="AAH13404.1"
FT                   /translation="MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGP
FT                   LSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAA
FT                   VVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPY
FT                   FKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGI
FT                   GGLELAAMIVSMYLYCNLQ"
FT   misc_difference 1277..1297
FT                   /gene="TSPAN1"
FT                   /note="polyA tail: 21 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1297 BP; 297 A; 335 C; 331 G; 334 T; 0 other;
     gagagccagg cgtccctctg cctgcccact cagtggcaac acccgggagc tgttttgtcc        60
     tttgtggagc ctcagcagtt ccctctttca gaactcactg ccaagagccc tgaacaggag       120
     ccaccatgca gtgcttcagc ttcattaaga ccatgatgat cctcttcaat ttgctcatct       180
     ttctgtgtgg tgcagccctg ttggcagtgg gcatctgggt gtcaatcgat ggggcatcct       240
     ttctgaagat cttcgggcca ctgtcgtcca gtgccatgca gtttgtcaac gtgggctact       300
     tcctcatcgc agccggcgtt gtggtctttg ctcttggttt cctgggctgc tatggtgcta       360
     agactgagag caagtgtgcc ctcgtgacgt tcttcttcat cctcctcctc atcttcattg       420
     ctgaggttgc agctgctgtg gtcgccttgg tgtacaccac aatggctgag cacttcctga       480
     cgttgctggt agtgcctgcc atcaagaaag attatggttc ccaggaagac ttcactcaag       540
     tgtggaacac caccatgaaa gggctcaagt gctgtggctt caccaactat acggattttg       600
     aggactcacc ctacttcaaa gagaacagtg cctttccccc attctgttgc aatgacaacg       660
     tcaccaacac agccaatgaa acctgcacca agcaaaaggc tcacgaccaa aaagtagagg       720
     gttgcttcaa tcagcttttg tatgacatcc gaactaatgc agtcaccgtg ggtggtgtgg       780
     cagctggaat tgggggcctc gagctggctg ccatgattgt gtccatgtat ctgtactgca       840
     atctacaata agtccacttc tgcctctgcc actactgctg ccacatggga actgtgaaga       900
     ggcaccctgg caagcagcag tgattggggg aggggacagg atctaacaat gtcacttggg       960
     ccagaatgga cctgcccttt ctgctccaga cttggggcta gatagggacc actcctttta      1020
     ggcgatgcct gactttcctt ccattggtgg gtggatgggt ggggggcatt ccagagcctc      1080
     taaggtagcc agttctgttg cccattcccc cagtctatta aacccttgat atgcccccta      1140
     ggcctagtgg tgatcccagt gctctactgg gggatgagag aaaggcattt tatagcctgg      1200
     gcataagtga aatcagcaga gcctctgggt ggatgtgtag aaggcacttc aaaatgcata      1260
     aacctgttac aatgttaaaa aaaaaaaaaa aaaaaaa                               1297
//

If you have problems or comments...

PBIL Back to PBIL home page