(data stored in ACNUC8465 zone)

EMBL: BC014830

ID   BC014830; SV 1; linear; mRNA; STD; MUS; 1551 BP.
XX
AC   BC014830;
XX
DT   10-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus mitogen-activated protein kinase kinase 2, mRNA (cDNA clone
DE   MGC:25475 IMAGE:4483473), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1551
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1551
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8a8774f71f8c269b7749f290c8cbbed3.
DR   Ensembl-Gn; ENSMUSG00000035027; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017536; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017514; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017476; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017299; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017930; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017271; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017377; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017448; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017397; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016926; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000105331; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026385; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026357; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026325; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026134; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026826; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026182; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025663; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: i Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31581583.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1551
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:25475 IMAGE:4483473"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1551
FT                   /gene="Map2k2"
FT                   /note="synonyms: MEK2, MK2"
FT   CDS_pept        183..1385
FT                   /codon_start=1
FT                   /gene="Map2k2"
FT                   /product="mitogen-activated protein kinase kinase 2"
FT                   /db_xref="GOA:Q91YS7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346867"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YS7"
FT                   /protein_id="AAH14830.1"
FT                   /translation="MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELD
FT                   LDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIH
FT                   LEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAK
FT                   RIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
FT                   MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGR
FT                   PVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSS
FT                   DFQEFVNKCLIKNPAERADLKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTA
FT                   V"
FT   misc_difference 1539..1551
FT                   /gene="Map2k2"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1551 BP; 330 A; 471 C; 481 G; 269 T; 0 other;
     ccgacctccc ggctgcgctg cagcgtcagc ttcactcggc ctcggcgtcg gtctgctcgc        60
     cccggcgctc cgggctcgtc cgccttccac cttctgcccg gcctaggccg cagccccggg       120
     cccgcgtcgc gccgccccct atgggccccg gctgaggcgt cgccgctggc cgtggagccc       180
     cgatgctggc ccggaggaag ccggtgttac cggcactcac tatcaaccct accatcgccg       240
     agggcccgtc ccccaccagc gagggcgcct ctgaggcaaa cctggtggac ctccagaaga       300
     agctggaaga gctggacctg gatgagcagc aaaggaagcg gctggaggcc ttccttaccc       360
     agaaggctaa ggtcggtgag ctcaaggacg acgactttga gaggatctca gagctgggtg       420
     ccggcaatgg cggagtggtc accaaggccc ggcataggcc gtcaggcctc atcatggcca       480
     gaaagctgat ccacctggag atcaaaccgg ccgtgcgcaa ccagatcatc cgggagctgc       540
     aggtgctgca cgagtgcaac tcgccctaca tcgtgggctt ctatggggcc ttctacagcg       600
     acggcgagat cagcatctgc atggagcaca tggatggtgg ctcactggac caggtactga       660
     aggaggccaa gcggattcct gaagacatct tggggaaggt cagcattgcg gtgctccggg       720
     gcctggccta cctccgagag aagcaccaga tcatgcacag agatgtgaag ccctccaaca       780
     tcctggtgaa ctctcgcggg gagattaagc tgtgtgactt cggggtgagc ggccagctga       840
     tcgactccat ggccaactcg tttgtaggga cgcgctccta catgtcccca gagcggctgc       900
     agggcaccca ctactctgtg cagtcggaca tctggagcat ggggctgtcg ctggtggagc       960
     tggccatcgg gaggtatccc attcccccac ctgatgccaa ggaactagag gccagctttg      1020
     gccggcctgt ggtggacggg gcagacggag aaccccatag tgtctccccg aggcccaggc      1080
     cccctggacg ccccatcagt ggtcatggga tggacagccg accggccatg gccatctttg      1140
     agctgctgga ctacatagtg aacgagccac ctcccaagct gcccagtggt gtgttcagct      1200
     cagacttcca ggagtttgtg aataaatgtc tcattaagaa cccagcagag cgagcagatc      1260
     tgaagctgct gatgaaccac gccttcatca agcgctctga gggggaggaa gtggacttcg      1320
     ccggctggct gtgcagaacc ctgcggctga agcagcccag cacacccacg cggactgcag      1380
     tgtgacagcc agcgcccagc agtctgtgtc cttgtccctg tcggcacagt ggccgctgcc      1440
     tctggggaca gtgatgctgt ttgttgtggc aggggaccta tgcccatgca tttgaaaacc      1500
     aaacaaaatg aagaaagaga aagaaagaaa gaaagctaaa aaaaaaaaaa a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page