(data stored in ACNUC1829 zone)

EMBL: BC019314

ID   BC019314; SV 2; linear; mRNA; STD; HUM; 1337 BP.
XX
AC   BC019314;
XX
DT   20-DEC-2001 (Rel. 70, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens tetraspanin 4, mRNA (cDNA clone MGC:4337 IMAGE:2821236),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1337
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1337
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 127278a5c8cd96538807f95603b56126.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
CC   On Aug 25, 2003 this sequence version replaced gi:17939509.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 9 Row: j Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 68799924.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1337
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_7"
FT                   /clone="MGC:4337 IMAGE:2821236"
FT                   /tissue_type="Lung, small cell carcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1337
FT                   /gene="TSPAN4"
FT                   /note="synonyms: TETRASPAN, TSPAN-4, NAG-2, NAG2"
FT   CDS_pept        121..837
FT                   /codon_start=1
FT                   /gene="TSPAN4"
FT                   /product="tetraspanin 4"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000038632.16"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="AAH19314.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
FT   misc_difference 286
FT                   /gene="TSPAN4"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 1319..1337
FT                   /gene="TSPAN4"
FT                   /note="polyA tail: 19 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1337 BP; 231 A; 432 C; 405 G; 269 T; 0 other;
     cagagcttgg ggcttccttg gtcgcaccca ccacctgcct gcccactggt cagccttcag        60
     ggaccctgag caccgcctgg tctctttcct gtggccagcc cagaactgaa gcgctgcggc       120
     atggcgcgcg cctgcctcca ggccgtcaag tacctcatgt tcgccttcaa cctgctcttc       180
     tggctgggag gctgtggcgt gctgggtgtc ggcatctggc tggccgccac acaggggagc       240
     ttcgccacgc tgtcctcttc cttcccgtcc ctgtcggctg ccaacctgct catcatcacc       300
     ggcgcctttg tcatggccat cggcttcgtg ggctgcctgg gtgccatcaa ggagaacaag       360
     tgcctcctgc tcactttctt cctgctgctg ctgctggtgt tcctgctgga ggccaccatc       420
     gccatcctct tcttcgccta cacggacaag attgacaggt atgcccagca agacctgaag       480
     aaaggcttgc acctgtacgg cacgcagggc aacgtgggcc tcaccaacgc ctggagcatc       540
     atccagaccg acttccgctg ctgtggcgtc tccaactaca ctgactggtt cgaggtgtac       600
     aacgccacgc gggtacctga ctcctgctgc ttggagttca gtgagagctg tgggctgcac       660
     gcccccggca cctggtggaa ggcgccgtgc tacgagacgg tgaaggtgtg gcttcaggag       720
     aacctgctgg ctgtgggcat ctttgggctg tgcacggcgc tggtgcagat cctgggcctg       780
     accttcgcca tgaccatgta ctgccaagtg gtcaaggcag acacctactg cgcgtaggcc       840
     gcccaccgcc cgcttctctg ccaaaaggac gcccacgggg agatggccgc acccacagct       900
     gcctttccca ccaccagcct cggtgctctg ccccatgctg ggaggaggga gggagggaca       960
     ggtgcctgga gcccccggaa ccctgtttct ggaaggccct agctcaggtg gcttcagggc      1020
     ctccggaccc cccctgggag gggtggccac gtgctggctg cggaacccag ggcaggggtg      1080
     ggaggggcct ccagcacttt ttatatttac gtattctcca aagcagtgtt cacacgggag      1140
     ccagcctgtg gcccccagcc tcctggaaaa caggttggcg ctggaggagc cgggtcttgg      1200
     catcctggag gtggccccac tggtcctggt gctccaggcg gggccgtgga cccctcacct      1260
     acattccata gtgggcccgt ggggctcctg gtgcatctta ataaagtgtg agcagcaaaa      1320
     aaaaaaaaaa aaaaaaa                                                     1337
//

If you have problems or comments...

PBIL Back to PBIL home page