(data stored in ACNUC7421 zone)

EMBL: BC020722

ID   BC020722; SV 1; linear; mRNA; STD; HUM; 1501 BP.
XX
AC   BC020722;
XX
DT   09-JAN-2002 (Rel. 70, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens AU RNA binding protein/enoyl-Coenzyme A hydratase, mRNA (cDNA
DE   clone MGC:22519 IMAGE:4656960), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1501
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1501
RA   Strausberg R.;
RT   ;
RL   Submitted (03-JAN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; c62140eccc3451a56a49c59751eeb629.
DR   Ensembl-Gn; ENSG00000148090; homo_sapiens.
DR   Ensembl-Tr; ENST00000303617; homo_sapiens.
DR   Ensembl-Tr; ENST00000375731; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 36 Row: i Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4502326.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1501
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_61"
FT                   /clone="MGC:22519 IMAGE:4656960"
FT                   /tissue_type="Testis, embryonal carcinoma"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:9606"
FT   gene            1..1501
FT                   /gene="AUH"
FT   CDS_pept        25..957
FT                   /codon_start=1
FT                   /product="AUH protein"
FT                   /db_xref="GOA:Q13825"
FT                   /db_xref="H-InvDB:HIT000038917.16"
FT                   /db_xref="HGNC:HGNC:890"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:1HZD"
FT                   /db_xref="PDB:2ZQQ"
FT                   /db_xref="PDB:2ZQR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13825"
FT                   /protein_id="AAH20722.1"
FT                   /translation="MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRA
FT                   GPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLS
FT                   KNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAANLPVPTIAAIDGLALGGGLELAL
FT                   ACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAV
FT                   GLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEA
FT                   CYAQTIPTKDRLEGLLAFKEKRPPRYKGE"
FT   misc_feature    268..936
FT                   /note="CaiD; Region: Enoyl-CoA hydratase/carnithine
FT                   racemase [Lipid metabolism]"
XX
SQ   Sequence 1501 BP; 470 A; 290 C; 375 G; 366 T; 0 other;
     aggtccacgc cgtaaacaga caacatggcg gccgcggtgg cggcggcacc tggggccttg        60
     ggatccctgc atgctggcgg cgcccgcctg gtggccgctt gcagtgcgtg gctctgcccg       120
     gggttgaggc tgcccggctc gttggcaggc cggcgagcgg gcccggcgat ctgggcccag       180
     ggctgggtac ctgcggccgg gggtcccgcc ccgaaaaggg gctacagctc tgagatgaag       240
     acggaggacg agctgcgggt gcggcacctg gaggaggaga accgaggaat tgtggtgctt       300
     ggaataaaca gagcttatgg caaaaattca ctcagtaaaa atcttataaa aatgctatca       360
     aaagctgtgg atgctttgaa atctgataag aaagtacgga ccataataat caggagtgaa       420
     gtcccaggga tattctgtgc tgctaatctt ccagtaccaa caattgcagc aatagatgga       480
     ctcgctttag gtggtggtct tgaactggct ttagcctgtg atatacgagt agcagcttcc       540
     tctgcaaaaa tgggcctggt tgaaacaaaa ttggcgatta ttcctggtgg aggggggaca       600
     cagcgattgc cacgcgccat tggaatgtcc ctggccaagg agctcatatt ctctgcgcga       660
     gtcctcgatg gcaaagaagc caaagcagtg ggcttaatca gccacgttct ggaacagaac       720
     caggagggag acgcggccta caggaaggcc ttggacctgg cgagagagtt tttacctcag       780
     ggacctgttg caatgagagt ggcaaaatta gcaattaatc aagggatgga ggtcgattta       840
     gtaacagggt tagccataga agaagcttgt tatgctcaga ccattccaac aaaagacaga       900
     cttgaaggtc ttcttgcttt taaagagaaa aggccccctc gctataaagg agaataaaag       960
     gaacagaaat tcttaagatg ccaatgtaat aaatgtactt cctggaagtg tctttcggat      1020
     ccactatatg cctcagcaca tggaacctta atgaccaaag tgaagagcag attattcata      1080
     cggtgtaata agcatctgga atggacccat ccgtgtactt cattcaaatg tgtaaatgtc      1140
     atattcattc agatttataa agctagtagt gtatagtcag aaacagaatc aaagttagat      1200
     atacattttt aaatatttac tgcatatgag gctttctgtt aattttttaa tgtgaataat      1260
     ttatatattg cacattctag ggaataatat tgattgtatg tctactgtgc tgcattaaga      1320
     aaataaaatt tctatatacc aaaaatgtga agttatacca aataaagttt ctaagtgatt      1380
     aatgcatacg aacagctaca tatacatata tctaaacctg aaaaatgaat tgatattctg      1440
     agtgaaaact acctaatata aataaaatta gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1500
     a                                                                      1501
//

If you have problems or comments...

PBIL Back to PBIL home page