(data stored in ACNUC9306 zone)

EMBL: BC020751

ID   BC020751; SV 1; linear; mRNA; STD; HUM; 1238 BP.
XX
AC   BC020751;
XX
DT   09-JAN-2002 (Rel. 70, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens radixin, mRNA (cDNA clone IMAGE:4691774), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1238
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1238
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-JAN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 60c4cc540303f98c01add5e20aae55ba.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: CLONTECH
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 36 Row: m Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 62244047.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 2).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1238
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_77"
FT                   /clone="IMAGE:4691774"
FT                   /tissue_type="Lung"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1238
FT                   /gene="RDX"
FT                   /note="synonym: DFNB24"
FT   misc_difference 48
FT                   /gene="RDX"
FT                   /note="'C' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   CDS_pept        211..>1238
FT                   /codon_start=1
FT                   /gene="RDX"
FT                   /product="RDX protein"
FT                   /db_xref="GOA:Q05CU6"
FT                   /db_xref="H-InvDB:HIT000090233.12"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/TrEMBL:Q05CU6"
FT                   /protein_id="AAH20751.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFF
FT                   GLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL
FT                   QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKL
FT                   TKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
FT                   LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAKKKKKKK
FT                   KK"
FT   misc_difference 1210..1238
FT                   /gene="RDX"
FT                   /note="polyA tail: 29 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1238 BP; 441 A; 230 C; 281 G; 286 T; 0 other;
     attgcggagc tgtctgcggt ggcggcggcg cctctcgtct cccgcggccc agcgctcgca        60
     ccaccgcttc tccctccctg tcgcagccgc gccgccgcgc agcgccccag ccacacgccg       120
     gcgggcagaa gccgcccgct ctccggaaag tgataacaga attcattgaa gtggagaatt       180
     tttaaagaag gtaacaaaaa gagaaagaaa atgccgaaac caatcaacgt aagagtaact       240
     acaatggatg ctgagctgga atttgccatt cagcccaata caactggcaa acaacttttt       300
     gaccaggtgg tgaaaacagt tggtttgcgt gaggtctggt tttttgggct gcagtatgta       360
     gacagcaaag gttattctac atggcttaaa ctaaataaaa aggtaacaca gcaggatgtt       420
     aaaaaagaga atcctttaca gttcaagttt agagctaaat tctttcctga agatgtttct       480
     gaggaattaa ttcaagaaat aacccagaga ctcttcttct tgcaagttaa agaagccatc       540
     ttaaatgatg agatatattg cccgccagaa actgcagttc ttttggcttc ctatgctgtc       600
     caagccaagt atggagatta caataaagag attcataagc caggctacct ggctaatgat       660
     agactcctac cccagcgtgt attggaacaa cacaaactaa caaaagaaca gtgggaagaa       720
     agaatacaga actggcatga agaacataga ggaatgttaa gggaggattc tatgatggaa       780
     tacctgaaga ttgcacaaga tctagaaatg tatggagtca actattttga aataaaaaat       840
     aaaaaaggaa ctgaattgtg gctaggtgtt gatgctttgg gtctgaatat ttatgagcat       900
     gacgacaagt taacacctaa aattggtttt ccctggagtg aaatcagaaa tatttcattt       960
     aatgacaaaa aatttgttat aaagccaatc gacaaaaagg cacctgattt tgtgttttat      1020
     gcacctcgtc tgagaatcaa taagcggatt ttggccttat gtatgggaaa ccatgaacta      1080
     tacatgcgaa gaaggaagcc tgatactatt gaagtacaac agatgaaggc tcaggctagg      1140
     gaggagaaac atcagaagca gttggaaagg gcacaattag agaatgaaaa gaagaaaaga      1200
     gaaatagcaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                              1238
//

If you have problems or comments...

PBIL Back to PBIL home page