(data stored in ACNUC6288 zone)

EMBL: BC021884

ID   BC021884; SV 1; linear; mRNA; STD; MUS; 1657 BP.
XX
AC   BC021884;
XX
DT   29-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus eukaryotic translation initiation factor 2B, subunit 4 delta,
DE   mRNA (cDNA clone MGC:25350 IMAGE:4168186), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1657
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1657
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-JAN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 18319f153b0fd5b2c0e7a7dfc239a7f7.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029415; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028523; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029217; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028604; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070903; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070802; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071008; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069628; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 30 Row: n Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6753735.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1657
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:25350 IMAGE:4168186"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1657
FT                   /gene="Eif2b4"
FT   CDS_pept        4..1578
FT                   /codon_start=1
FT                   /gene="Eif2b4"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="AAH21884.1"
FT                   /translation="MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQ
FT                   QKKKRKEEKGADQEIGSAVSAAQRQDPIRELPGPGSQLGGTAGEKLPAGRSKAELRAER
FT                   RAKQEAERALKQARKGEQGGVPPQACPSTAGETTSGVKRVPEHTPADDPTLLRRLLRKP
FT                   DRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLISG
FT                   SNARCIALLHALQQVIQDYTTPPSEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFL
FT                   TKEVTGMSSSKREEEAKSELREALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGCS
FT                   SLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPEV
FT                   SKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNEL
FT                   DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVL
FT                   RVKSSDQ"
FT   misc_difference 1613..1657
FT                   /gene="Eif2b4"
FT                   /note="polyA tail: 45 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1657 BP; 440 A; 430 C; 461 G; 326 T; 0 other;
     gtcatggctg cggtggcggt ggctgttcgc gaagaatcga gatccgagat gaagactgaa        60
     ctttctcctc ggcccggggc agcagggcgg gagttgaccc aagaagagaa gcttcagctt       120
     cgaaaagaaa agaaacagca gaagaagaaa cggaaggagg aaaagggggc agaccaagaa       180
     attggctctg ctgtgtctgc agctcaacgg caagacccaa tcagagaact cccaggacct       240
     ggtagtcagc tgggaggtac tgctggggag aaacttccag ctggccggag taaggcagaa       300
     cttcgcgccg aaaggagagc caagcaggag gcagagcggg ccctgaaaca ggcaagaaaa       360
     ggggaacaag gaggcgtccc tcctcaggcc tgccccagca ctgctggaga aaccacctca       420
     ggagtgaagc gtgtccccga gcacacccca gctgatgacc ccacacttct gaggaggctc       480
     cttagaaagc cagatcgaca acaggttcct acacgaaagg attacggatc caaagtcagt       540
     ctcttctccc acctgcctca gtacagcaga caaagctcct tgacccagta catgagcatc       600
     ccatcctctg tgatccaccc agccatggtg agactcggtc tgcagtactc ccagggcctc       660
     atcagtggct ccaatgcccg gtgcatcgca ctgcttcacg ccctgcagca ggtgattcag       720
     gattacacaa cacctcccag tgaggaactc tccagggatc ttgtaaataa actaaaaccc       780
     tacatcagct tcctgacgca gtgccgcccc atgtcggcaa gtatgtgcaa cgccatcaag       840
     ttcctaacca aggaagtcac tggcatgagc agctccaagc gggaagagga ggccaagtca       900
     gaacttagag aagccctcga ccggtacgtg caagagaaga tcgtgcttgc agctcaggca       960
     atttcacgat ttgcttctac aaagatcagt gatggggacg tgatcctggt atatggatgc      1020
     tcatctttgg tgtcgagaat tctccaggag gccagggtcg agggcaggcg gtttcgggtg      1080
     gtggtggtgg acagccggcc ccggctggaa ggaaggcaca tgctccactc tcttgtccgt      1140
     gctggggtcc ctacctccta tctgctgatt cctgcagcct cctatgtgct tccagaggtt      1200
     tctaaggtgc tattgggagc tcatgcactc ctggccaatg gatctgtgat gtctcgggta      1260
     gggacagcac agttggccct ggtggctcga gctcataacg ttccagtact ggtctgctgt      1320
     gaaacgtaca agttctgtga acgtgtgcag actgatgcct ttgtctccaa cgagctagat      1380
     gatcccgatg atctgcagtg taagcgggga gaccaggtgg ccctggctaa ctggcagagc      1440
     cacccgtccc tccggttgtt gaatctggtc tatgacgtga ctccacctga gctcgtggat      1500
     ctggtgatca cagagttggg catgatccct tgcagttctg tgcctgttgt tcttcgagtc      1560
     aagagcagtg accagtgaag ggaacaaggg tcaataaaaa gcttactccc taaaaaaaaa      1620
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                               1657
//

If you have problems or comments...

PBIL Back to PBIL home page