(data stored in ACNUC10243 zone)

EMBL: BC023828

ID   BC023828; SV 1; linear; mRNA; STD; SYN; 1554 BP.
XX
AC   BC023828;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   06-SEP-2016 (Rel. 129, Last updated, Version 11)
XX
DE   Synthetic construct Mus musculus heterogeneous nuclear ribonucleoprotein
DE   A3, mRNA (cDNA clone MGC:38324 IMAGE:5343619), complete cds.
XX
KW   MGC.
XX
OS   synthetic construct
OC   other sequences; artificial sequences.
XX
RN   [1]
RP   1-1554
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1554
RA   Director MGC Project;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; c80c395eb8fffc8376e3d19c31305744.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: b Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 22122656.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 37) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1554
FT                   /organism="synthetic construct"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /isolation_source="Mus musculus; FVB/N; Mammary tumor.
FT                   C3(1)-Tag model. Infiltrating ductal carcinoma. 5 month old
FT                   virgin mouse."
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38324 IMAGE:5343619"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:32630"
FT   gene            1..1554
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT   misc_difference 1..32
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /note="32 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 35
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   CDS_pept        79..1152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /product="Hnrpa3 protein"
FT                   /db_xref="GOA:Q8BG05"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG05"
FT                   /protein_id="AAH23828.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFG
FT                   GRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGY
FT                   GGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYG
FT                   GGYGSGGGSGGYGSRRF"
FT   misc_difference 1539..1554
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1554 BP; 459 A; 215 C; 473 G; 407 T; 0 other;
     ccacgcgtcc gcggacgcgt gggcggacgc gtgggcccat attgaactcg agttggaaga        60
     ggcgagtccg gtctcaaaat ggagggccat gatccaaagg aaccagagca gctgaggaag       120
     ctatttattg gtggtctgag ctttgaaacc acagatgata gcttaagaga acattttgag       180
     aaatggggca cacttacaga ctgtgtggta atgagagatc cccaaacaaa acgttccaga       240
     ggctttggtt ttgtgaccta ctcttgtgtt gaagaggtgg atgctgcaat gtgtgctcgg       300
     ccacacaagg ttgatgggcg tgtggtggaa ccgaagagag ctgtttctag agaggattct       360
     gtaaagcctg gtgcccattt aacggtgaag aaaatttttg ttggtggtat taaagaggat       420
     acggaagaat ataacctgag agactacttt gaaaagtatg gcaagattga aaccatagag       480
     gttatggaag acaggcagag tgggaaaaag agaggatttg cttttgtaac ttttgatgat       540
     catgacacag ttgataaaat tgttgttcag aaataccaca ctattaatgg gcataattgt       600
     gaagtgaaaa aggccctttc taaacaagag atgcagtctg ctggatcaca gagaggtcgt       660
     ggaggtggat ctggcaactt tatgggtcgt ggaggaaact ttggaggtgg tggaggaaac       720
     tttggtcgtg gaggaaactt tggtggaaga ggtggctatg gtggtggagg tggtggcagc       780
     agaggtagtt atggaggtgg tgatggtgga tataatggat ttggaggtga tggtggcaac       840
     tatggtggtg gtcctggtta cagcagtaga ggaggttatg gaggtggtgg accaggatat       900
     ggaaaccagg gtggtggata tggtggtgga ggaggaggct atgatggtta caatgaagga       960
     ggaaattttg gtggaggtaa ctatggtggt ggtggaaact ataatgactt tggaaattat      1020
     agtggacagc aacaatcaaa ttatggaccc atgaaggggg gcagttttgg tggaagaagc      1080
     tcaggcagtc cctatggtgg tggctatgga tctggaggtg gaagtggtgg atatggtagc      1140
     agaaggtttt aaaataaaac agaaacggct acagttctta gcaggagaga gagcgaggag      1200
     ttgtcaggaa agctgcaggt tactttgaga cagtcgtccc aaatgcatta gaggaactgt      1260
     aaaaatctgc cacagaagga acgatgatcc atagtcagaa aagttactgc agcttaaaca      1320
     ggaaaccctt cttgttcagg actgtcatag ccacagtttg caaaaagtgc agctattgat      1380
     taatgcaatg tagtgtcaat tagatgtaca ttcctgaggt cttttatctg ttgtagcttt      1440
     gtctttttct ttttcttttc attacatcag gtatattgcc ctgtaaattg tggtagtggt      1500
     accaggaata aaaaattaag gaatttttaa cttttcaaaa aaaaaaaaaa aaaa            1554
//

If you have problems or comments...

PBIL Back to PBIL home page