(data stored in ACNUC10243 zone)

EMBL: BC023908

ID   BC023908; SV 1; linear; mRNA; STD; MUS; 1873 BP.
XX
AC   BC023908;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 18)
XX
DE   Mus musculus heterogeneous nuclear ribonucleoprotein A3, mRNA (cDNA clone
DE   MGC:36410 IMAGE:5322033), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1873
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1873
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9f7f3d3db77fc5914e6d12feb37fb761.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000090792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164947; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 56 Row: i Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31559915.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1873
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:36410 IMAGE:5322033"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1873
FT                   /gene="Hnrpa3"
FT                   /note="synonyms: MGC37309, hnRNPA3"
FT   misc_difference 1..10
FT                   /gene="Hnrpa3"
FT                   /note="10 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS_pept        29..1168
FT                   /codon_start=1
FT                   /gene="Hnrpa3"
FT                   /product="heterogeneous nuclear ribonucleoprotein A3"
FT                   /db_xref="GOA:Q8BG05"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG05"
FT                   /protein_id="AAH23908.1"
FT                   /translation="MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGP
FT                   GYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQ
FT                   QSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
FT   misc_difference 1861..1873
FT                   /gene="Hnrpa3"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1873 BP; 556 A; 269 C; 535 G; 513 T; 0 other;
     ccacgcgtcc ggcgagtccg gtctcaaaat ggaggtaaaa ccgccgcccg gtcgccccca        60
     gcctgactcc ggccgtcgcc gccgccgccg gggggaggag ggccatgatc caaaggaacc       120
     agagcagctg aggaagctat ttattggtgg tctgagcttt gaaaccacag atgatagctt       180
     aagagaacat tttgagaaat ggggcacact tacagactgt gtggtaatga gagatcccca       240
     aacaaaacgt tccagaggct ttggttttgt gacctactct tgtgttgaag aggtggatgc       300
     tgcaatgtgt gctcggccac acaaggttga tgggcgtgtg gtggaaccga agagagctgt       360
     ttctagagag gattctgtaa agcctggtgc ccatttaacg gtgaagaaaa tttttgttgg       420
     tggtattaaa gaggatacgg aagaatataa cctgagagac tactttgaaa agtatggcaa       480
     gattgaaacc atagaggtta tggaagacag gcagagtggg aaaaagagag gatttgcttt       540
     tgtaactttt gatgatcatg acacagttga taaaattgtt gttcagaaat accacactat       600
     taatgggcat aattgtgaag tgaaaaaggc cctttctaaa caagagatgc agtctgctgg       660
     atcacagaga ggtcgtggag gtggatctgg caactttatg ggtcgtggag gaaactttgg       720
     aggtggtgga ggaaactttg gtcgtggagg aaactttggt ggaagaggtg gctatggtgg       780
     tggaggtggt ggcagcagag gtagttatgg aggtggtgat ggtggatata atggatttgg       840
     aggtgatggt ggcaactatg gtggtggtcc tggttacagc agtagaggag gttatggagg       900
     tggtggacca ggatatggaa accagggtgg tggatatggt ggtggaggag gaggctatga       960
     tggttacaat gaaggaggaa attttggtgg aggtaactat ggtggtggtg gaaactataa      1020
     tgactttgga aattatagtg gacagcaaca atcaaattat ggacccatga aggggggcag      1080
     ttttggtgga agaagctcag gcagtcccta tggtggtggc tatggatctg gaggtggaag      1140
     tggtggatat ggtagcagaa ggttttaaaa taaaacagaa acggctacag ttcttagcag      1200
     gagagagagc gaggagttgt caggaaagct gcaggttact ttgagacagt cgtcccaaat      1260
     gcattagagg aactgtaaaa atctgccaca gaaggaacga tgatccatag tcagaaaagt      1320
     tactgcagct taaacaggaa acccttcttg ttcaggactg tcatagccac agtttgcaaa      1380
     aagtgcagct attgattaat gcaatgtagt gtcaattaga tgtacattcc tgaggtcttt      1440
     tatctgttgt agctttgtct ttttcttttt cttttcatta catcaggtat attgccctgt      1500
     aaattgtggt agtggtacca ggaataaaaa attaaggaat ttttaacttt tcaatatttg      1560
     tgtagttcag tttttctaca ttttagtaca gaaactttaa caaaatgcag tttcgaaggt      1620
     gtttccttgt gagttaacac gtgaagaaga tcattgttaa ttactatttt gtatgaattt      1680
     tgctaaagtt aactgtaaag aaacacctac tgacttgcaa tttaagggga atctattctc      1740
     cccatttcca aaacaatgat gaatgggcgc tgacatgtgg agagaataga tatttgtatg      1800
     tttgcaatgt gtgttttaga taattagaat tgggaaataa aaaaatagca tatttgtgaa      1860
     aaaaaaaaaa aaa                                                         1873
//

If you have problems or comments...

PBIL Back to PBIL home page