(data stored in ACNUC15465 zone)

EMBL: BC024914

ID   BC024914; SV 1; linear; mRNA; STD; HUM; 637 BP.
XX
AC   BC024914;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens G antigen 5, mRNA (cDNA clone MGC:21275 IMAGE:4471969),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-637
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-637
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0074088553312b38ce56a3fba288b026.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 28 Row: c Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4503876.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..637
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_90"
FT                   /clone="MGC:21275 IMAGE:4471969"
FT                   /tissue_type="Liver, adenocarcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..637
FT                   /gene="GAGE5"
FT   CDS_pept        88..441
FT                   /codon_start=1
FT                   /gene="GAGE5"
FT                   /product="G antigen 5"
FT                   /db_xref="GOA:Q13069"
FT                   /db_xref="H-InvDB:HIT000039843_06.4"
FT                   /db_xref="HGNC:HGNC:4102"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13069"
FT                   /protein_id="AAH24914.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
FT   misc_difference 154
FT                   /gene="GAGE5"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'V' in cDNA, 'M' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 310
FT                   /gene="GAGE5"
FT                   /note="'G' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'H' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 533..637
FT                   /gene="GAGE5"
FT                   /note="polyA tail: 105 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 637 BP; 254 A; 114 C; 158 G; 111 T; 0 other;
     aagaacgcca gggagctgtg aggcagtgct gtgtggttcc tgccgtccgg actctttttc        60
     ctctactgag attcatctgt gtgaaatatg agttggcgag gaagatcgac ctattattgg       120
     cctagaccaa ggcgctatgt acagcctcct gaagtgattg ggcctatgcg gcccgagcag       180
     ttcagtgatg aagtggaacc agcaacacct gaagaagggg aaccagcaac tcaacgtcag       240
     gatcctgcag ctgctcagga gggagaggat gagggagcat ctgcaggtca agggccgaag       300
     cctgaagctg atagccagga acagggtcac ccacagactg ggtgtgagtg tgaagatggt       360
     cctgatgggc aggagatgga cccgccaaat ccagaggagg tgaaaacgcc tgaagaaggt       420
     gaaaagcaat cacagtgtta aaagaaggca cgttgaaatg atgcaggctg ctcctatgtt       480
     ggaaatttgt tcattaaaat tctcccaata aagctttaca gccttctgca aaaaaaaaaa       540
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       600
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                                637
//

If you have problems or comments...

PBIL Back to PBIL home page