(data stored in ACNUC7421 zone)

EMBL: BC025104

ID   BC025104; SV 1; linear; mRNA; STD; MUS; 1226 BP.
XX
AC   BC025104;
XX
DT   12-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus enoyl Coenzyme A hydratase domain containing 2, mRNA (cDNA
DE   clone MGC:36265 IMAGE:3591648), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1226
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1226
RA   Director MGC Project;
RT   ;
RL   Submitted (05-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 698b94d58779ff47863dbfb4a4fe2659.
DR   Ensembl-Gn; ENSMUSG00000028601; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028549; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027681; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028214; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027762; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116309; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0066644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0065658; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 61 Row: c Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21312019.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1226
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="CZECH II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:36265 IMAGE:3591648"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1226
FT                   /gene="Echdc2"
FT   misc_difference 78
FT                   /gene="Echdc2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 186
FT                   /gene="Echdc2"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   CDS_pept        189..929
FT                   /codon_start=1
FT                   /gene="Echdc2"
FT                   /product="Echdc2 protein"
FT                   /db_xref="GOA:Q3TLP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TLP5"
FT                   /protein_id="AAH25104.1"
FT                   /translation="MNRPHARNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFC
FT                   AGADLKEREQMSDVEVGTFVQRLRGLMSEIAAFPAPTIAAMDGFALGGGLELALACDLR
FT                   IAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNH
FT                   AVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMCYAQN
FT                   IPTQDRLEGMAAFREKRAPKFVGK"
FT   misc_difference 201
FT                   /gene="Echdc2"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'H' in cDNA, 'N' in the mouse genome."
FT   misc_difference 427
FT                   /gene="Echdc2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; amino acid
FT                   difference: 'A' in cDNA, 'V' in the mouse genome."
FT   misc_difference 449
FT                   /gene="Echdc2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 599
FT                   /gene="Echdc2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 713
FT                   /gene="Echdc2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 792
FT                   /gene="Echdc2"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 982^983
FT                   /gene="Echdc2"
FT                   /note="15 bases in the mouse genome are not found in cDNA."
FT   misc_difference 1054..1055
FT                   /gene="Echdc2"
FT                   /note="in the mouse genome : TT."
FT   misc_difference 1081
FT                   /gene="Echdc2"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1090..1097
FT                   /gene="Echdc2"
FT                   /note="8 bases do not align to the mouse genome."
FT   misc_difference 1114
FT                   /gene="Echdc2"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1122
FT                   /gene="Echdc2"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1137
FT                   /gene="Echdc2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1165..1172
FT                   /gene="Echdc2"
FT                   /note="8 bases in cDNA are not found in the mouse genome."
FT   misc_difference 1185
FT                   /gene="Echdc2"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 1208..1226
FT                   /gene="Echdc2"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1226 BP; 279 A; 348 C; 348 G; 251 T; 0 other;
     gtcccgttct ccgcgccacc ttgccggcct gctccccgat gctacgcgta ctgccccgcg        60
     cgctgcgcct cccgtgcccc tggaggttct cgggggcccg ggactgcgcc tctcacgcga       120
     cgaccaggac acccgaaatc caagtgcagg ctctgacagg tcccaaccaa ggaatcactg       180
     agattgtgat gaacagacct catgcccgca atgccttggg gaatgtgttt gttagtgagc       240
     tgctggaagc tctggcccag cttcgggaag accagcaagt ccgggtcctg ctcttcagaa       300
     gtgcggtgaa gggagtgttc tgtgcaggtg cagacctgaa ggagcgggag cagatgagtg       360
     atgtggaggt ggggaccttt gtccagcggc tccgaggcct gatgagtgag atcgcagcct       420
     tccctgcgcc caccattgca gccatggacg ggtttgcctt aggcgggggc ttggaacttg       480
     ccctggcctg tgacctccga atagcagctt cttcggctgt catggggcta attgagacca       540
     ctcgaggact tctcccagga gcaggaggga ctcagaggct gcctcgctgc ctgggcgtag       600
     ccctagcgaa ggagctcatc ttcacaggcc ggcgactgaa cggggcacag gcccgtgagt       660
     tgggcctggt aaatcatgcc gtggctcaga atgaggaggg taacgctgcc tatcaccggg       720
     ccctggcact ggcacaggag atcctgcccc aggctcccat tgctgtgcgc ctgggcaaag       780
     ttgccatcga ccgaggaatg gaggtggaca ttgcatcagg gatggccata gaacagatgt       840
     gctatgccca gaacatccca acccaggaca ggctggaagg aatggcagcc ttcagggaga       900
     aacgagctcc caaatttgtg ggcaagtgac ccagctaact ttaagcacac accataaagt       960
     ctagatcatc cagagaacca agtgcactgc caccttccat actgctcacc ttggctagtg      1020
     actggactct ctgcattcaa aaacttcggg tctgcgtcat tggctctgat caccatggat      1080
     ggagcaatgc cctcagactc cagctctctg taatgcaagg gtaattctgg acaaaccatt      1140
     taacctctct atcagtctct ctgacgactt aatatccctg tgttcaataa acatgctgca      1200
     actgttaaaa aaaaaaaaaa aaaaaa                                           1226
//

If you have problems or comments...

PBIL Back to PBIL home page