(data stored in ACNUC7421 zone)

EMBL: BC025454

ID   BC025454; SV 1; linear; mRNA; STD; MUS; 817 BP.
XX
AC   BC025454;
XX
DT   13-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus enoyl Coenzyme A hydratase domain containing 2, mRNA (cDNA
DE   clone MGC:38500 IMAGE:5352625), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-817
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-817
RA   Director MGC Project;
RT   ;
RL   Submitted (06-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 16e29f9f52daed721a749a8fcb06de75.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: k Column: 19.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..817
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38500 IMAGE:5352625"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..817
FT                   /gene="Echdc2"
FT   misc_difference 1..10
FT                   /gene="Echdc2"
FT                   /note="10 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS_pept        60..467
FT                   /codon_start=1
FT                   /gene="Echdc2"
FT                   /product="Echdc2 protein"
FT                   /db_xref="GOA:Q8R3H3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1289238"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R3H3"
FT                   /protein_id="AAH25454.1"
FT                   /translation="MGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQAR
FT                   ELGLVNHAVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIE
FT                   QMCYAQNIPTQDRLEGMAAFREKRAPKFVGK"
FT   misc_difference 511
FT                   /gene="Echdc2"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 792..817
FT                   /gene="Echdc2"
FT                   /note="polyA tail: 26 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 817 BP; 217 A; 218 C; 208 G; 174 T; 0 other;
     ccacgcgtcc ggaacttgcc ctggcctgtg acctccgaat agcagcttct tcggctgtca        60
     tggggctaat tgagaccact cgaggacttc tcccaggagc aggagggact cagaggctgc       120
     ctcgctgcct gggcgtggcc ctagcgaagg agctcatctt cacaggccgg cgactgaacg       180
     gggcacaggc ccgtgagttg ggcctggtaa atcatgccgt ggctcagaat gaggagggta       240
     acgctgccta ccaccgggcc ctggcactgg cacaggagat cctgccccag gctcccattg       300
     ctgtgcgcct gggcaaagtt gccatcgaca gaggaatgga ggtggacatt gcatcaggga       360
     tggccataga acagatgtgc tatgcccaga acatcccaac ccaggacagg ctggaaggaa       420
     tggcagcctt cagggagaaa cgagctccca aatttgtggg caagtgaccc agctaacttt       480
     aagcacacac cataaagtct agatcatcca aagaaccaag gtactgacca tgcagtgcac       540
     tgccaccttc catactgctc accttggcta gtgactggac tctctgcatt caaaaacttc       600
     gggtctttgt cattggctct gatcaccatg gatagagcaa tgaggactta cttactctca       660
     cagagtttct ttgagttagt gtcaggagcc ctccagctct ctgtaacgca aggggaattc       720
     tggacaaact atttaacctc tctatcagtc tctctgatat ccctgtgtta ataaacatgc       780
     tgcaactgtt aaaaaaaaaa aaaaaaaaaa aaaaaaa                                817
//

If you have problems or comments...

PBIL Back to PBIL home page