(data stored in ACNUC8465 zone)

EMBL: BC028260

ID   BC028260; SV 1; linear; mRNA; STD; SYN; 2149 BP.
XX
AC   BC028260;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   06-SEP-2016 (Rel. 129, Last updated, Version 13)
XX
DE   Synthetic construct Mus musculus mitogen-activated protein kinase kinase 5,
DE   mRNA (cDNA clone MGC:40633 IMAGE:5067818), complete cds.
XX
KW   MGC.
XX
OS   synthetic construct
OC   other sequences; artificial sequences.
XX
RN   [1]
RP   1-2149
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2149
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b64086ec6edf41a180812fc8feb32a0c.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 65 Row: c Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754623.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 37) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2149
FT                   /organism="synthetic construct"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /isolation_source="Mus musculus; Czech II; Mammary tumor
FT                   metastatized to lung. Tumor arose spontaneously from a
FT                   senescent normal mammary (clonal) outgrowth infected with
FT                   the virus MMTV."
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:40633 IMAGE:5067818"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:32630"
FT   gene            1..2149
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT   misc_difference 1..47
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="47 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 97
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   misc_difference 356
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   CDS_pept        476..1795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /product="Map2k5 protein"
FT                   /db_xref="GOA:Q9WVS7"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR034851"
FT                   /db_xref="MGI:MGI:1346345"
FT                   /db_xref="PDB:1WI0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVS7"
FT                   /protein_id="AAH28260.1"
FT                   /translation="MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL
FT                   DVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQI
FT                   FPRACKPPGERNIHGLKVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNE
FT                   QDIRYRDTLGHGNGGTVYKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSS
FT                   YIIGFYGAFFVENRISICTEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILH
FT                   RDVKPSNMLVNTGGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVW
FT                   SLGISFMELALGRFPYPQPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQCMRKQPKERP
FT                   APEELMGHPFIVQFNDGNSTVVSMWVCRALEERRSQQGPP"
FT   misc_difference 892
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1600
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="'T' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1962
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2015
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2114..2149
FT                   /gene="Map2k5"
FT                   /gene_synonym="Mapkk5"
FT                   /gene_synonym="MEK5"
FT                   /gene_synonym="Prkmk5"
FT                   /note="polyA tail: 36 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2149 BP; 527 A; 549 C; 559 G; 514 T; 0 other;
     ccacgcgtcc gcggacgcgt gggcggacgc gtgggcggac gcgtgggagc ccgcggcgcc        60
     cggccaccgt ccccttgccc accgagacac tcaggaaggc aggaccctgg ccactgtacc       120
     tgccttaaac caggccgttg ctccgctgtc tcctcttact cacaaggact acagaatgct       180
     tgtgggttct gttttgtcca cttttgtaac tccaggacct tccgctctct actaattcct       240
     cttggccggt cccccaacag tgcatcctct cctagggaca ctccacacga cctgggcctg       300
     gttttgggcc tgcaagctcc ctcctgatcg ctcctcttca cttctcccca tcttcctgct       360
     ccctatttat cgcctgcctt ctgtctatcg ttccccttgt cacttcttgg ggctcctcct       420
     aagtaggggc aggtcggtac ccctcgcccc aggatgtgag accctttaac ctgtaatgct       480
     gtggctggcc cttggcccct tctgtgccat ggagaaccag gtgctggtga ttcggatcaa       540
     gattccaaat agtggcgcgg tggactggac cgtgcactcc gggccgcagt tactcttcag       600
     ggatgttctg gatgtgatag gccaggttct gcctgaagcg acgacgacag cgtttgaata       660
     tgaagatgaa gatggtgata ggattacagt aagaagcgat gaagagatga aggcaatgct       720
     gtcctactat tattccacag taatggaaca gcaagtaaat ggccagctaa tagagccgct       780
     gcagatattt ccaagagcct gcaagcctcc tggggaacgg aacatacatg gcctgaaggt       840
     gaatacacgg gctgggccat ctcaacacac cagccctgtg gtctcagatt cacttccaag       900
     caatagcttg aagaagtcct cagctgaact gagaaagata ctggccaacg gccagatgaa       960
     tgaacaagac atacggtatc gagacaccct tggtcatggc aacggaggca cagtctacaa      1020
     agcacatcat gtcccaagtg ggaaaatttt agctgtaaag gttattctgt tagacattac      1080
     actggagctt cagaagcaga tcatgtctga gctggaaatc ctttataagt gtgactcatc      1140
     gtatatcata ggattttacg gggcattttt cgtagaaaac aggatttcaa tttgtacaga      1200
     attcatggat ggggggtctt tggatgtata taggaaaatt ccagagcacg tccttggaag      1260
     aattgcagtt gcagttgtta aaggccttac ctatctgtgg agtttaaaga ttttacacag      1320
     agatgtgaag ccctccaaca tgcttgtaaa cacaggcgga caggtcaagc tgtgtgactt      1380
     tggcgtgagc acacagctgg tgaattctat agccaagacg tatgttggaa caaatgctta      1440
     catggcacca gaaagaattt caggagagca gtatgggatc cattctgacg tgtggagctt      1500
     aggaatctct ttcatggagc ttgctcttgg gaggtttcca tatcctcagc ctctccagct      1560
     tctgcagtgc attgttgatg aggattcgcc ggtccttcct cttggagagt tctcggagcc      1620
     gtttgtacat ttcatcactc agtgcatgag gaagcagccc aaggagagac cggcgcctga      1680
     ggagctgatg ggtcacccat tcatcgtgca gttcaatgat ggaaactcca ctgtggtgtc      1740
     catgtgggtg tgccgagctc tagaggagag gcggagccag cagggacccc cgtgagacct      1800
     cagcaggaca ctgaccactg aggaccagtc atcatgacac agcaagccgt gacccctctg      1860
     tctgctgtac tggcccagcc tcctgctcgc acctcctgcc ctacctagga agccctccag      1920
     agggccagcc tctgctgagc gggggaagtg ggcactgact atagcaggtg gagatggtgc      1980
     agggcggggt gatgaggtta taaaactatg gaacttcctc tggccccacc cccttatctt      2040
     tccctactgt tcattgtaaa gggtcaggcc ctatcagcag cactgatggg aataaaagta      2100
     ttattgcttt ggaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                  2149
//

If you have problems or comments...

PBIL Back to PBIL home page