(data stored in ACNUC8465 zone)

EMBL: BC029833

ID   BC029833; SV 2; linear; mRNA; STD; MUS; 2373 BP.
XX
AC   BC029833;
XX
DT   26-MAY-2002 (Rel. 71, Created)
DT   20-JAN-2018 (Rel. 135, Last updated, Version 9)
XX
DE   Mus musculus mitogen-activated protein kinase kinase 4, mRNA (cDNA clone
DE   MGC:36532 IMAGE:3962163), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2373
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2373
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-2373
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-JAN-2018) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ec0799087dcf6d7520993cd59d17a54e.
XX
CC   On Jan 18, 2018 this sequence version replaced BC029833.1.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 61 Row: e Column: 15.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2373
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:36532 IMAGE:3962163"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2373
FT                   /gene="Map2k4"
FT                   /gene_synonym="JNKK1"
FT                   /gene_synonym="MEK4"
FT                   /gene_synonym="MKK4"
FT                   /gene_synonym="PRKMK4"
FT                   /gene_synonym="Sek1"
FT   CDS_pept        129..974
FT                   /codon_start=1
FT                   /gene="Map2k4"
FT                   /gene_synonym="JNKK1"
FT                   /gene_synonym="MEK4"
FT                   /gene_synonym="MKK4"
FT                   /gene_synonym="PRKMK4"
FT                   /gene_synonym="Sek1"
FT                   /product="Map2k4 protein"
FT                   /db_xref="GOA:Q8K2U0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K2U0"
FT                   /protein_id="AAH29833.1"
FT                   /translation="MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
FT                   "
XX
SQ   Sequence 2373 BP; 688 A; 521 C; 531 G; 633 T; 0 other;
     tgagaacaca cagcattgag tcatcaggaa aactgaagat ctcccctgaa caacactggg        60
     atttcactgc agaggacttg aaagaccttg gagaaattgg acgaggagct tatggttctg       120
     tcaacaaaat ggtccacaaa ccaagtgggc agataatggc agttaaaaga attcggtcaa       180
     ctgtggatga aaaagaacaa aaacaacttc tcatggattt ggatgtagta atgcggagta       240
     gtgattgccc atacattgtt cagttctatg gtgcactctt cagagagggc gactgttgga       300
     tctgtatgga gctcatgtct acctcgttcg ataagtttta caaatatgta tatagtgtgt       360
     tagatgacgt tattccggaa gagatcttag gcaaaatcac tttagcaact gtgaaagcac       420
     taaaccactt aaaagaaaac ttgaaaatta ttcacagaga catcaaacct tccaatattc       480
     ttctggacag aagtggaaat ataaagctct gtgatttcgg catcagtgga cagcttgtgg       540
     actctattgc caagacaaga gatgctgggt gtaggccgta tatggcacct gaaagaatag       600
     acccaagtgc atcaagacaa gggtatgatg tccgctctga tgtctggagt ttggggatca       660
     cattgtacga gttggccaca ggccgatttc cttatccaaa gtggaatagt gtatttgatc       720
     agctaacaca agtggtgaaa ggagaccctc cgcagctgag taattctgaa gaaagggagt       780
     tctcccccag tttcatcaac tttgtcaact tgtgccttac gaaggatgaa tccaaaaggc       840
     caaagtataa agagcttctg aaacatccct ttattttgat gtatgaagaa cgtactgtag       900
     aggtcgcatg ctatgtttgt aaaatcctgg atcagatgcc agccactccc agctcgccca       960
     tgtatgtcga ctgataccgc tgctacatca gactctagaa aaaagggctg aggggaagca      1020
     agacgtaaag agttttcatc ctgtatcaca gtgtttttat tgctcgccca gacaccatgt      1080
     gcaataagac tggtgttcgt ttccatcatg tctgtatact tctgtcatct agactgtgca      1140
     tccctgtaat acctgactga tcacagtgtt agtgctggtc agagagacct catcctgctc      1200
     ttttgtgatg aacatattca tgacgcgtgg aagtcagtac gatcaagttg ttgactgtga      1260
     ttagatcaca ccttaattca tttctagact caaaacctgg agacgcagct actggaatgg      1320
     tgttttgtga gacttccaag gctggaaaga cacagtcatg gatgtactgt ctgagcatag      1380
     agaacccggg cttgagtgag aagagcttgc acagccagtg agacacattg ccttctgcag      1440
     ctgggagaca gaggaaggat tccctttctt caccaagtgc aatagatttc ctcatctgat      1500
     aggctgttgc tttaccgtca cacgcgatgt gctcagccaa attccctact caaaatatca      1560
     tgttaaatta gaatttatct ttaccaaaaa ccatgttgct ttcagagagg tcaacattaa      1620
     aatactgaga caggacagaa tgtgttcttt gtccttttcc agccctgctc ttctctggga      1680
     agatacagga gtctgccacc tgtcatagaa gggtgctgcc aacttgatgc tctacctgcc      1740
     accaaccacc aggactgaag gaaggaaaca gtactgaggg caaagtttac agatgttttt      1800
     gattctggca ttttgtccag aacagcttgt agcagctata gattccccct tggccccaag      1860
     cctgggactt gagccatcgt aactcactaa cagggagaat tagctagtag caatgtgcct      1920
     tgatgaagat ttcctgcagg cagcaaaaca ccaaatcaca acgctttgct tctcgacatc      1980
     atgggccagg tcctcagttt ctaactcttt cccttcccca cagttcgttg tcgccatgcg      2040
     gcttttgctc agtctagtat tctgccttgt ttttcacatt gggaacccta acattaccag      2100
     ggatgctact taccacaatt tgtaaccctg aatctctcct gtgctctggt gttcagaaag      2160
     ctgagacagc tgggcccagt tgatgttgta cgtgagaaag aggcagtctg ttggagaggc      2220
     atacttgagc aggataaaga tcctaaatgg cagcctttca gataggcatg tctgacacct      2280
     gctgaggcct ctaccagttc actctctccc ttggaagtgg aattctaccc acctaaaccc      2340
     cccaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page