(data stored in ACNUC15465 zone)

EMBL: BC031628

ID   BC031628; SV 1; linear; mRNA; STD; HUM; 606 BP.
XX
AC   BC031628;
XX
DT   28-JUN-2002 (Rel. 72, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 60)
XX
DE   Homo sapiens G antigen 12I, mRNA (cDNA clone MGC:34597 IMAGE:5168892),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-606
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-606
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 659ead20b4ae7482c115c5153f6197a6.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 51 Row: b Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4503876.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..606
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_119"
FT                   /clone="MGC:34597 IMAGE:5168892"
FT                   /tissue_type="Brain, adult medulla"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..606
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT   CDS_pept        73..426
FT                   /codon_start=1
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /product="G antigen 12I"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="H-InvDB:HIT000041341_06.4"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAH31628.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
FT   misc_difference 521..606
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /note="polyA tail: 86 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 606 BP; 232 A; 112 C; 151 G; 111 T; 0 other;
     ctgtgaggca gtgctgtgtg gttcctgccg tccggactct ttttcctcta ctgagattca        60
     tctgtgtgaa atatgagttg gcgaggaaga tcgacctatt attggcctag accaaggcgc       120
     tatgtacagc ctcctgaaat gattgggcct atgcggcccg agcagttcag tgatgaagtg       180
     gaaccagcaa cacctgaaga aggggaacca gcaactcaac gtcaggatcc tgcagctgct       240
     caggagggag aggatgaggg agcatctgca ggtcaagggc cgaagcctga agctcatagc       300
     caggaacagg gtcacccaca gactgggtgt gagtgtgaag atggtcctga tgggcaggag       360
     atggacccgc caaatccaga ggaggtgaaa acgcctgaag aaggtgaaaa gcaatcacag       420
     tgttaaaaga aggcacgttg aaatgatgca ggctgctcct atgttggaaa tttgttcatt       480
     aaaattctcc caataaagct ttacagcctt ctgcaaagaa aaaaaaaaaa aaaaaaaaaa       540
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa       600
     aaaaaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page