(data stored in ACNUC8465 zone)

EMBL: BC032478

ID   BC032478; SV 1; linear; mRNA; STD; HUM; 2252 BP.
XX
AC   BC032478;
XX
DT   28-JUN-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Homo sapiens mitogen-activated protein kinase kinase 3, mRNA (cDNA clone
DE   MGC:40348 IMAGE:5215093), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2252
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2252
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8de5922fae1dd4ceb7b36e178c7d638b.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000316920; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
DR   Ensembl-Tr; ENST00000361818; homo_sapiens.
DR   Ensembl-Tr; ENST00000613338; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 64 Row: l Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21618348.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2252
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_118"
FT                   /clone="MGC:40348 IMAGE:5215093"
FT                   /tissue_type="Blood, adult leukocytes"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..2252
FT                   /gene="MAP2K3"
FT                   /note="synonyms: MAPKK3, MEK3, MKK3"
FT   CDS_pept        201..1244
FT                   /codon_start=1
FT                   /gene="MAP2K3"
FT                   /product="mitogen-activated protein kinase kinase 3"
FT                   /db_xref="GOA:P46734"
FT                   /db_xref="H-InvDB:HIT000041560.18"
FT                   /db_xref="HGNC:HGNC:6843"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46734"
FT                   /protein_id="AAH32478.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVK
FT                   EILGEDS"
FT   misc_difference 560
FT                   /gene="MAP2K3"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 2247..2252
FT                   /gene="MAP2K3"
FT                   /note="polyA tail: 6 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 2252 BP; 459 A; 687 C; 631 G; 475 T; 0 other;
     cggcgccgcc cgtcgcggac tcgtccttgc tgcagtcgcc gccgcagtcc tcgccgcagt        60
     cgccgccgcc gccgccgccg ccgccgctgc tcctccgcct ggcctgggcc gtctgcccgc       120
     agccatgagc gtgctcggcc ccggtggagc ccgcagtcct ctagattagt ctccaccgcc       180
     gtccaggacc cacttgcagc atggagtcgc ccgcctcgag ccagcccgcc agcatgcccc       240
     agtccaaagg aaaatccaag aggaagaagg atctacggat atcctgcatg tccaagccac       300
     ccgcacccaa ccccacaccc ccccggaacc tggactcccg gaccttcatc accattggag       360
     acagaaactt tgaggtggag gctgatgact tggtgaccat ctcagaactg ggccgtggag       420
     cctatggggt ggtagagaag gtgcggcacg cccagagcgg caccatcatg gccgtgaagc       480
     ggatccgggc caccgtgaac tcacaggagc agaagcggct gctcatggac ctggacatca       540
     acatgcgcac ggtcgactgc ttctacactg tcaccttcta cggggcacta ttcagagagg       600
     gagacgtgtg gatctgcatg gagctcatgg acacatcctt ggacaagttc taccggaagg       660
     tgctggataa aaacatgaca attccagagg acatccttgg ggagattgct gtgtctatcg       720
     tgcgggccct ggagcatctg cacagcaagc tgtcggtgat ccacagagat gtgaagccct       780
     ccaatgtcct tatcaacaag gagggccatg tgaagatgtg tgactttggc atcagtggct       840
     acttggtgga ctctgtggcc aagacgatgg atgccggctg caagccctac atggcccctg       900
     agaggatcaa cccagagctg aaccagaagg gctacaatgt caagtccgac gtctggagcc       960
     tgggcatcac catgattgag atggccatcc tgcggttccc ttacgagtcc tgggggaccc      1020
     cgttccagca gctgaagcag gtggtggagg agccgtcccc ccagctccca gccgaccgtt      1080
     tctcccccga gtttgtggac ttcactgctc agtgcctgag gaagaacccc gcagagcgta      1140
     tgagctacct ggagctgatg gagcacccct tcttcacctt gcacaaaacc aagaagacgg      1200
     acattgctgc cttcgtgaag gagatcctgg gagaagactc ataggggctg ggcctcggac      1260
     cccactccgg ccctccagag ccccacagcc ccatctgcgg gggcagtgct cacccacacc      1320
     ataagctact gccatcctgg cccagggcat ctgggaggaa ccgagggggc tgctcccacc      1380
     tggctctgtg gcgagccatt tgtcccaagt gccaaagaag cagaccattg gggctcccag      1440
     ccaggccctt gtcggcccca ccagtgcctc tccctgctgc tcctaggacc cgtctccagc      1500
     tgctgagatc ctggactgag ggggcctgga tgccccctgt ggatgctgct gcccctgcac      1560
     agcaggctgc cagtgcctgg gtggatgggc caccgccttg cccagcctgg atgccatcca      1620
     agttgtatat ttttttaatc tctcgactga atggactttg cacactttgg cccagggtgg      1680
     ccacacctct atcccggctt tggtgcgggg tacacaagag gggatgagtt gtgtgaatac      1740
     cccaagactc ccatgaggga gatgccatga gccgcccaag gccttcccct ggcactggca      1800
     aacagggcct ctgcggagca cactggctca cccagtcctg cccgccaccg ttatcggtgt      1860
     cattcacctt tcgtgttttt tttaatttat cctctgttga ttttttcttt tgctttatgg      1920
     gtttggcttg tttttcttgc atggtttgga gctgatcgct tctcccccac cccctagggt      1980
     accagcaggc agagccttgc cctctgctca ggctggggtc cagtgggagg ggcccaagat      2040
     ctctgctcag agaagtgcag ggggagcctt ccagctcact ctccctgagg actggcttga      2100
     caggggctat gggtttgctt tggtgttgtt tttaaaaaaa gaaaatatat ttttttgaaa      2160
     aaacgactgc ccatcccggg tcctttccct gatgggttgg ggcagttacc tggttgctgt      2220
     tttaattaaa aaaaaaaaaa aaaaaaaaaa aa                                    2252
//

If you have problems or comments...

PBIL Back to PBIL home page