(data stored in ACNUC30630 zone)

EMBL: BC034304

ID   BC034304; SV 1; linear; mRNA; STD; HUM; 1262 BP.
XX
AC   BC034304;
XX
DT   09-JUL-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens pseudouridylate synthase-like 1, mRNA (cDNA clone MGC:30098
DE   IMAGE:4778177), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1262
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1262
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a9625e6a261cd7dc70fe2ac9a1677d98.
DR   Ensembl-Gn; ENSG00000169972; homo_sapiens.
DR   Ensembl-Tr; ENST00000379031; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: James Cleaver, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 42 Row: e Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 23503258.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Skn3"
FT                   /clone="MGC:30098 IMAGE:4778177"
FT                   /tissue_type="Skin, normal"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:9606"
FT   gene            1..1262
FT                   /gene="PUSL1"
FT                   /note="synonym: FLJ90811"
FT   CDS_pept        31..942
FT                   /codon_start=1
FT                   /gene="PUSL1"
FT                   /product="pseudouridylate synthase-like 1"
FT                   /db_xref="GOA:Q8N0Z8"
FT                   /db_xref="H-InvDB:HIT000042093.16"
FT                   /db_xref="HGNC:HGNC:26914"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N0Z8"
FT                   /protein_id="AAH34304.1"
FT                   /translation="MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLE
FT                   EAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRH
FT                   PAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWTLPADCLDMV
FT                   AMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNL
FT                   EFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKS
FT                   VLYGNLGAASCTLQGPQFGSHG"
FT   misc_difference 1241..1262
FT                   /gene="PUSL1"
FT                   /note="polyA tail: 22 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1262 BP; 242 A; 434 C; 375 G; 211 T; 0 other;
     cgcctctgac gccaccggct gggctccgcc atgagttcgg cgccggcctc aggctccgtg        60
     cgcgcgcgct atcttgtgta cttccagtac gtgggcaccg actttaacgg ggtcgcggcc       120
     gtcaggggca ctcagcgcgc cgtcggggtc cagaactacc tggaggaggc cgccgagcgg       180
     ctgaattccg tggagccggt caggttcacc atctccagcc gcacggacgc cggggtccac       240
     gccctgagca acgcggcgca cctggacgtc cagcgccgct caggccggcc gcccttcccg       300
     cccgaggtcc tggccgaggc cctcaacaca cacctgcggc acccggccat cagggtcctg       360
     cgggccttcc gagtgcccag cgacttccac gctcgtcacg cagccacgtc ccggacctac       420
     ctgtaccgcc tggccactgg ctgtcaccgg cgtgatgagc tgccggtgtt tgaacgcaac       480
     ctatgctgga ctctcccggc agactgcctg gatatggtcg ccatgcagga agccgcccag       540
     cacctcctcg gcacacacga cttcagcgcc ttccagtccg ctggcagccc ggtgccgagc       600
     cccgtgcgaa cgctgcgccg ggtctccgtt tccccaggcc aagccagccc cttggtcacc       660
     cccgaggaga gcaggaagct gcggttctgg aacctggagt ttgagagcca gtctttcctg       720
     tatagacagg tacggaggat gacggctgtg ctggtggccg tggggctggg ggctttggca       780
     cctgcccagg tgaagacgat tctggagagc caagatcccc tgggcaagca ccagacacgt       840
     gtagccccag cccacggctt attcctcaag tcagtgctgt acgggaacct cggtgctgcc       900
     tcctgcaccc tgcaggggcc acagttcggg agccacggat gaccctggac actcaagcca       960
     aagttaggcc acaccaggcc caaccctgtg ctggtcaagc cagggcagtc acagctgctt      1020
     ggggcccaca gcactgctgc ctggtctcca cagtagcctc cctgcccggg tcccagcacc      1080
     ctggatgccc gtctctgtcc caggcgggat ggggcacagt gcaggacaca gccatgtaca      1140
     ccaagaagag agtaccaagt agtcttttgt tcagctttta ctggaaactg ctgtctagga      1200
     ccacctgccc taaccaggaa taaaggcaag acagcctgga aaaaaaaaaa aaaaaaaaaa      1260
     aa                                                                     1262
//

If you have problems or comments...

PBIL Back to PBIL home page