(data stored in SCRATCH zone)

EMBL: BC034687

ID   BC034687; SV 1; linear; mRNA; STD; HUM; 458 BP.
XX
AC   BC034687;
XX
DT   28-JUL-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens S100 calcium binding protein A7, mRNA (cDNA clone MGC:21353
DE   IMAGE:4751685), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-458
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-458
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 40c5b040f63b5f833595847a5ab544f2.
DR   Ensembl-Gn; ENSG00000143556; homo_sapiens.
DR   Ensembl-Tr; ENST00000368722; homo_sapiens.
DR   Ensembl-Tr; ENST00000368723; homo_sapiens.
DR   EuropePMC; PMC6138313; 30460084.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: James Cleaver, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 28 Row: o Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31341192
CC   This clone grew slowly and was rescued by PCR.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..458
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Skn4"
FT                   /clone="MGC:21353 IMAGE:4751685"
FT                   /tissue_type="Skin, squamous cell carcinoma"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:9606"
FT   gene            1..458
FT                   /gene="S100A7"
FT                   /note="synonym: S100A7c"
FT   CDS_pept        40..345
FT                   /codon_start=1
FT                   /gene="S100A7"
FT                   /product="S100 calcium binding protein A7"
FT                   /db_xref="GOA:P31151"
FT                   /db_xref="H-InvDB:HIT000051199.14"
FT                   /db_xref="HGNC:HGNC:10497"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028477"
FT                   /db_xref="InterPro:IPR034325"
FT                   /db_xref="PDB:1PSR"
FT                   /db_xref="PDB:2PSR"
FT                   /db_xref="PDB:2WND"
FT                   /db_xref="PDB:2WOR"
FT                   /db_xref="PDB:2WOS"
FT                   /db_xref="PDB:3PSR"
FT                   /db_xref="PDB:4AQJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31151"
FT                   /protein_id="AAH34687.1"
FT                   /translation="MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLS
FT                   ACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ"
FT   misc_difference 123
FT                   /gene="S100A7"
FT                   /note="'C' in cDNA is 'G' in the human genome; amino acid
FT                   difference: 'D' in cDNA, 'E' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 406..458
FT                   /gene="S100A7"
FT                   /note="polyA tail: 53 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 458 BP; 176 A; 106 C; 94 G; 82 T; 0 other;
     ctcgtgacgc ttcccagctc tggctttttg aaagcaaaga tgagcaacac tcaagctgag        60
     aggtccataa taggcatgat cgacatgttt cacaaataca ccagacgtga tgacaagatt       120
     gacaagccaa gcctgctgac gatgatgaag gagaacttcc ccaacttcct tagtgcctgt       180
     gacaaaaagg gcacaaatta cctcgccgat gtctttgaga aaaaggacaa gaatgaggat       240
     aagaagattg atttttctga gtttctgtcc ttgctgggag acatagccac agactaccac       300
     aagcagagcc atggagcagc gccctgttcc gggggcagcc agtgacccag ccccaccaat       360
     gggcctccag agaccccagg aacaataaaa tgtcttctcc caccaaaaaa aaaaaaaaaa       420
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                               458
//

If you have problems or comments...

PBIL Back to PBIL home page