(data stored in ACNUC8465 zone)

EMBL: BC036032

ID   BC036032; SV 1; linear; mRNA; STD; HUM; 3757 BP.
XX
AC   BC036032;
XX
DT   22-SEP-2002 (Rel. 73, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens mitogen-activated protein kinase kinase 4, mRNA (cDNA clone
DE   MGC:33126 IMAGE:5272439), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3757
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3757
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JUL-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 882283c6981952ff5abf98c97e7327ff.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
CC   cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
CC   Toshiyuki and Piero Carninci (RIKEN)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 48 Row: d Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 24497520.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3757
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_97"
FT                   /clone="MGC:33126 IMAGE:5272439"
FT                   /tissue_type="Testis"
FT                   /note="Vector: pBluescriptR"
FT                   /db_xref="taxon:9606"
FT   gene            1..3757
FT                   /gene="MAP2K4"
FT                   /note="synonyms: MKK4, MAPKK4, SEK1, JNKK, JNKK1, MEK4,
FT                   PRKMK4"
FT   CDS_pept        70..1269
FT                   /codon_start=1
FT                   /gene="MAP2K4"
FT                   /product="mitogen-activated protein kinase kinase 4"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000094222.14"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="AAH36032.1"
FT                   /translation="MAAPSPSGGGGSGGGRGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
FT   misc_difference 115
FT                   /gene="MAP2K4"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'R' in cDNA, 'S' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 2597
FT                   /gene="MAP2K4"
FT                   /note="'A' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 2834
FT                   /gene="MAP2K4"
FT                   /note="'C' in cDNA is 'T' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 3741
FT                   /gene="MAP2K4"
FT                   /note="'A' in cDNA is 'T' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 3744..3757
FT                   /gene="MAP2K4"
FT                   /note="polyA tail: 14 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 3757 BP; 1103 A; 788 C; 796 G; 1070 T; 0 other;
     ggccgtgcga gaggccgagc ttgctgcatt gcagccgccg cggcgccgct cggctcttca        60
     ctcccaacaa tggcggctcc gagcccgagc ggcggcggcg gctccggggg cggccgcggc       120
     agcggcaccc ccggccccgt agggtccccg gcgccaggcc acccggccgt cagcagcatg       180
     cagggtaaac gcaaagcact gaagttgaat tttgcaaatc cacctttcaa atctacagca       240
     aggtttactc tgaatcccaa tcctacagga gttcaaaacc cacacataga gagactgaga       300
     acacacagca ttgagtcatc aggaaaactg aagatctccc ctgaacaaca ctgggatttc       360
     actgcagagg acttgaaaga ccttggagaa attggacgag gagcttatgg ttctgtcaac       420
     aaaatggtcc acaaaccaag tgggcaaata atggcagtta aaagaattcg gtcaacagtg       480
     gatgaaaaag aacaaaaaca acttcttatg gatttggatg tagtaatgcg gagtagtgat       540
     tgcccataca ttgttcagtt ttatggtgca ctcttcagag agggtgactg ttggatctgt       600
     atggaactca tgtctacctc gtttgataag ttttacaaat atgtatatag tgtattagat       660
     gatgttattc cagaagaaat tttaggcaaa atcactttag caactgtgaa agcactaaac       720
     cacttaaaag aaaacttgaa aattattcac agagatatca aaccttccaa tattcttctg       780
     gacagaagtg gaaatattaa gctctgtgac ttcggcatca gtggacagct tgtggactct       840
     attgccaaga caagagatgc tggctgtagg ccatacatgg cacctgaaag aatagaccca       900
     agcgcatcac gacaaggata tgatgtccgc tctgatgtct ggagtttggg gatcacattg       960
     tatgagttgg ccacaggccg atttccttat ccaaagtgga atagtgtatt tgatcaacta      1020
     acacaagtcg tgaaaggaga tcctccgcag ctgagtaatt ctgaggaaag ggaattctcc      1080
     ccgagtttca tcaactttgt caacttgtgc cttacgaagg atgaatccaa aaggccaaag      1140
     tataaagagc ttctgaaaca tccctttatt ttgatgtatg aagaacgtgc cgttgaggtc      1200
     gcatgctatg tttgtaaaat cctggatcaa atgccagcta ctcccagctc tcccatgtat      1260
     gtcgattgat atcgctgcta catcagactc tagaaaaaag ggctgagagg aagcaagacg      1320
     taaagaattt tcatcccgta tcacagtgtt tttattgctc gcccagacac catgtgcaat      1380
     aagattggtg ttcgtttcca tcatgtctgt atactcctgt cacctagaac gtgcatcctt      1440
     gtaatacctg attgatcaca cagtgttagt gctggtcaga gagacctcat cctgctcttt      1500
     tgtgatgaac atattcatga aatgtggaag tcagtacgat caagttgttg actgtgatta      1560
     gatcacatct taaattcatt tctagactca aaacctggag atgcagctac tggaatggtg      1620
     ttttgtcaga cttccaaatc ctggaaggac acagtgatga atgtactatg tctgaacata      1680
     gaaactcggg cttgagtgag aagagcttgc acagccaacg agacacattg ccttctggag      1740
     ctgggagaca aaggaggaat ttactttctt caccaagtgc aatagattac tgatgtgata      1800
     ttctgttgct ttacagttac agttgatgtt tggggatcga tgtgctcagc caaatttcct      1860
     gtttgaaata tcatgttaaa ttagaatgaa tttatcttta ccaaaaacca tgttgcgttc      1920
     aaagaggtga acattaaaat atagagacag gacagaatgt gttcttttct cctttaccag      1980
     tcctattttt caatgggaag actcaggagt ctgccacttg tcaaagaagg tgctgatcct      2040
     aagaattttt cattctcaga attcggtgtg ctgccaactt gatgttccac ctgccacaaa      2100
     ccaccaggac tgaaagaaga aaacagtaca gaaggcaaag tttacagatg tttttaattc      2160
     tagtatttta tctggaacaa cttgtagcag ctatatattt ccccttggtc ccaagcctga      2220
     tactttagcc atcataactc actaacaggg agaagtagct agtagcaatg tgccttgatt      2280
     gattagataa agatttctag taggcagcaa aagaccaaat ctcagttgtt tgcttcttgc      2340
     catcactggt ccaggtcttc agtttccgaa tctctttccc ttcccctgtg gtctattgtc      2400
     gctatgtgac ttgcgcttaa tccaatattt tgcctttttt ctatatcaaa aaacctttac      2460
     agttagcagg gatgttcctt accaaggatt tttagcccca aatctctcat attcgctagt      2520
     gtttaaaagg ctaagaatag tggggcccag ccgatgtggt aggtgataaa gaggcatctt      2580
     ttctagagac acattgaacc agatgaggat ccgaaacggc agcctttacg ttcatcacct      2640
     gctagaacct ctcgtagtcc atcaccattt cttggcattg gaattctact ggaaaaaaat      2700
     acaaaaagca aaacaaaacc ctcagcactg ttacaagagg ccatttaagt atcttgtgct      2760
     tcttcactta cccattagcc aggttctcat taggttttgc ttgggcctcc ctggcactga      2820
     accttaggct ttgcatgaca gtgaagcagc actgtgagtg gttcaagcac actggaatat      2880
     aaaacagtca tggcctgaga tgcaggtgat gccattacag aaccaaatcg tggcacgtat      2940
     tgctgtgtct cctctcagag tgacagtcat aaatactgtc aaacaataaa gggagaatgg      3000
     tgctgtttaa agtcacatcc ctgtaaattg cagaattcaa aagtgattat ctctttgatc      3060
     tacttgcctc atttccctat cttctccccc acggtatcct aaactttaga cttcccactg      3120
     ttctgaaagg agacattgct ctatgtctgc cttcgaccac agcaagccat catcctccat      3180
     tgctcccggg gactcaagag gaatctgttt ctctgctgtc aacttcccat ctggctcagc      3240
     atagggtcac tttgccatta tgcaaatgga gataaaagca attctgactg tccaggagct      3300
     aatctgaccg ttctattgtg tggatgacca cataagaagg caattttagt gtattaatca      3360
     tagattatta taaactataa acttaagggc aaggagttta ttacaatgta tctttattaa      3420
     aacaaaaggg tgtatagtgt tcacaaactg tgaaaatagt gtaagaactg tacattgtga      3480
     gctctggtta tttttctctt gtaccataga aaaatgtata aaaattatca aaaagctaat      3540
     gtgcagggat attgccttat ttgtctgtaa aaaatggagc tcagtaacat aactgcttct      3600
     tggagctttg gaatatttta tcctgtattc ttgtttgaat tcctcctcta tttaagatat      3660
     atacatggaa tcgaagtgtt tatgtaatag ttctatcctt ttgcctgcag gtcagttgta      3720
     ataaatctag gatgtgatga agaaaaaaaa aaaaaaa                               3757
//

If you have problems or comments...

PBIL Back to PBIL home page