(data stored in ACNUC10243 zone)

EMBL: BC038364

ID   BC038364; SV 1; linear; mRNA; STD; MUS; 2621 BP.
XX
AC   BC038364;
XX
DT   05-OCT-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus heterogeneous nuclear ribonucleoprotein A3, mRNA (cDNA clone
DE   MGC:36649 IMAGE:5362605), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2621
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2621
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f7e7a92b0bdcf869df70dfc82a7b6aa6.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000090792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164947; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: b Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 37674276.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2621
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:36649 IMAGE:5362605"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2621
FT                   /gene="Hnrpa3"
FT                   /note="synonyms: MGC37309, hnRNPA3"
FT   CDS_pept        42..1181
FT                   /codon_start=1
FT                   /gene="Hnrpa3"
FT                   /product="heterogeneous nuclear ribonucleoprotein A3"
FT                   /db_xref="GOA:Q8BG05"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG05"
FT                   /protein_id="AAH38364.1"
FT                   /translation="MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGP
FT                   GYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQ
FT                   QSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
FT   misc_difference 2604..2621
FT                   /gene="Hnrpa3"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2621 BP; 763 A; 430 C; 696 G; 732 T; 0 other;
     catattgaac tcgagttgga agaggcgagt ccggtctcaa aatggaggta aaaccgccgc        60
     ccggtcgccc ccagcctgac tccggccgtc gccgccgccg ccggggggag gagggccatg       120
     atccaaagga accagagcag ctgaggaagc tatttattgg tggtctgagc tttgaaacca       180
     cagatgatag cttaagagaa cattttgaga aatggggcac acttacagac tgtgtggtaa       240
     tgagagatcc ccaaacaaaa cgttccagag gctttggttt tgtgacctac tcttgtgttg       300
     aagaggtgga tgctgcaatg tgtgctcggc cacacaaggt tgatgggcgt gtggtggaac       360
     cgaagagagc tgtttctaga gaggattctg taaagcctgg tgcccattta acggtgaaga       420
     aaatttttgt tggtggtatt aaagaggata cggaagaata taacctgaga gactactttg       480
     aaaagtatgg caagattgaa accatagagg ttatggaaga caggcagagt gggaaaaaga       540
     gaggatttgc ttttgtaact tttgatgatc atgacacagt tgataaaatt gttgttcaga       600
     aataccacac tattaatggg cataattgtg aagtgaaaaa ggccctttct aaacaagaga       660
     tgcagtctgc tggatcacag agaggtcgtg gaggtggatc tggcaacttt atgggtcgtg       720
     gaggaaactt tggaggtggt ggaggaaact ttggtcgtgg aggaaacttt ggtggaagag       780
     gtggctatgg tggtggaggt ggtggcagca gaggtagtta tggaggtggt gatggtggat       840
     ataatggatt tggaggtgat ggtggcaact atggtggtgg tcctggttac agcagtagag       900
     gaggttatgg aggtggtgga ccaggatatg gaaaccaggg tggtggatat ggtggtggag       960
     gaggaggcta tgatggttac aatgaaggag gaaattttgg tggaggtaac tatggtggtg      1020
     gtggaaacta taatgacttt ggaaattata gtggacagca acaatcaaat tatggaccca      1080
     tgaagggggg cagttttggt ggaagaagct caggcagtcc ctatggtggt ggctatggat      1140
     ctggaggtgg aagtggtgga tatggtagca gaaggtttta aaataaaaca gaaacggtga      1200
     atgagaaccc tacctgccta acgaggaatg tctttcccac accttaaata cgaaggtttc      1260
     tggctgggta aggtttgtag ctcacagtaa aaaccgatga cactgttggt ttcccacaag      1320
     tcaatgtcac agttgagaca cccctcaagc tcagttttgt tttggtgccc attgaacaaa      1380
     ttctaagaca taggcagtta cattctgcaa agccatgggt gtttgtcata agctagatgt      1440
     gcctcttcat gtgtacaact caatgttcta aggtaaagtc atccttcaat aaggggaagt      1500
     catgttggct tttcaaaagt aagtttttca tgtatgactt taataagctg ttcccaccct      1560
     aagaactagg aactttcaca gttgtcagaa taattgtctt ccttaaagct ctatagcgtg      1620
     taagtttact cttgtgtgga ccagtaggga tagtcaagtg tttagtcttc tcccctaacc      1680
     catcacaaac agggtctcac tgttgtccta gcctggaact caatccacca gccttctgtg      1740
     tctcccaagt gctggagtta aaagggtggt gcctgtatga taactcaagt tcctttttaa      1800
     aaaaacatcc aaagaacagt tgggttacta ttcacataat gttgctggtt gttcataagg      1860
     gctatttctg ctgccctgaa agggcttatt tgaaaattgc ttaattcagg ttacttctta      1920
     atagaacatt ttcaggggac aaatctgcaa aatgtttccc acacagggaa catccctgca      1980
     tcaacaagtt tgcttggcat ttaagtcagg acaaagttca cagaaatcat agttaccaat      2040
     gaggtagcaa tcgttcaatg gtggttaaca gattggagaa aatacatttg cttaggaggc      2100
     atttacagtc catttccttt ctgaaataaa gttattttac taatatggtt ccactgtcat      2160
     ttctgcaaaa acactttaca atggtagaag ggtaagcata aaacaaaaga ggctgcctct      2220
     ggttttgttg gacctgtggg atgctgctcc cagtttacat gtctgaaagg tgtgttcaca      2280
     ttcgtgtata aattagggga cacatggtaa gaaaaagtcc atctagtagg ggactacaga      2340
     gaaatgggct cggtttttaa gggttctgtt aatgtcacaa tttgaaacgc tcctgacaat      2400
     agttcagtaa ttggcatggt agcaagcatg cagatgtgca aggtgctgtg aggattggta      2460
     gcctgagtat tcagttttaa acttaacatg tcttctaatc tttatgacag cagaggtggt      2520
     ctgtaattca attgttttca tttgtagcat aatgaaatgt tacagaaaga tgaccttttc      2580
     attaaaatat ttttagaaat gtgaaaaaaa aaaaaaaaaa a                          2621
//

If you have problems or comments...

PBIL Back to PBIL home page