(data stored in ACNUC24361 zone)

EMBL: BC041661

ID   BC041661; SV 1; linear; mRNA; STD; HUM; 3931 BP.
XX
AC   BC041661;
XX
DT   27-DEC-2002 (Rel. 74, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Homo sapiens zinc finger and SCAN domain containing 12, mRNA (cDNA clone
DE   MGC:47655 IMAGE:6063526), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3931
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3931
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-DEC-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c025330d27e1e06d03f2097c3c53e6de.
DR   Ensembl-Gn; ENSG00000158691; homo_sapiens.
DR   Ensembl-Tr; ENST00000361028; homo_sapiens.
DR   Ensembl-Tr; ENST00000396827; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC/DCTD/DTP
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 82 Row: p Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 44917602.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3931
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_72"
FT                   /clone="MGC:47655 IMAGE:6063526"
FT                   /tissue_type="Skin, melanotic melanoma."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..3931
FT                   /gene="ZSCAN12"
FT                   /note="synonyms: ZFP96, ZNF29K1, dJ29K1.2"
FT   CDS_pept        144..1958
FT                   /codon_start=1
FT                   /gene="ZSCAN12"
FT                   /product="zinc finger and SCAN domain containing 12"
FT                   /db_xref="GOA:O43309"
FT                   /db_xref="H-InvDB:HIT000052585.16"
FT                   /db_xref="HGNC:HGNC:13172"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43309"
FT                   /protein_id="AAH41661.1"
FT                   /translation="MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVF
FT                   RQYFRQFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQA
FT                   WVQEQHPESGEEVVTVLEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQ
FT                   SMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSAR
FT                   CGETREPEEITEEPSACSREDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGK
FT                   AFSQHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFG
FT                   RWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRS
FT                   ILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQ
FT                   HQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQR
FT                   IHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLK
FT                   NHSEPQAGVNLLLSSLIPEWQSCFRRDL"
FT   misc_difference 2747
FT                   /gene="ZSCAN12"
FT                   /note="'C' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 3817
FT                   /gene="ZSCAN12"
FT                   /note="1 base in cDNA is not found in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 3913..3931
FT                   /gene="ZSCAN12"
FT                   /note="polyA tail: 19 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 3931 BP; 1227 A; 795 C; 909 G; 1000 T; 0 other;
     gggtcccaaa agggttcgag gcctcttgcc ttcgctccgt aggagggagt tctcttctgg        60
     ccctgggggc cgcaggactg tccaggaata cagtttccag gtgagatctt acttgaaaca       120
     ccggtagttc tagcacagct aaaatggcat ctacttgggc tatccaggcc cacatggacc       180
     aggatgaacc tttggaagta aagatagagg aagagaaata taccaccaga caggattggg       240
     acctgcgtaa aaacaacacc catagcagag aggtcttccg tcagtacttc agacagttct       300
     gctaccagga gacatctggt ccccgtgagg ctttgagccg actccgagaa ctttgccatc       360
     agtggctgag gccagagacc cacaccaaag aacagattct ggagctgctg gtgctggagc       420
     agttcctgac catcctacct gaggagctcc aggcctgggt gcaggagcag catccagaga       480
     gtggggagga ggtggtgact gtgctggagg atttagagag agaactggat gaaccaggag       540
     agcaggtctc agtccacact ggggaacagg aaatgttctt gcaggagacg gtacgtctac       600
     gaaaagaagg agaacccagt atgtccctcc agtccatgaa agcccagcca aagtatgaat       660
     ctccagaact tgaatcccaa caggagcaag ttttagatgt tgagactgga aatgagtatg       720
     ggaatttaaa gcaagaagtt tctgaagaaa tggaaccaca tgggaagaca tccagtaaat       780
     ttgaaaatga tatgtccaag tctgctaggt gtggagaaac tcgtgaacct gaagaaataa       840
     cagaagagcc ctctgcttgc tccagagaag ataaacaacc tacctgtgat gaaaatggag       900
     taagcctgac tgagaactct gaccatactg aacatcagag aatctgtcca ggagaagaat       960
     cttacggatg tgatgactgt ggaaaagctt ttagtcagca ctcacacctc atagaacatc      1020
     agaggatcca tactggagat agaccctaca aatgcgaaga atgtggaaaa gctttccgtg      1080
     ggagaactgt gcttattcga cacaaaataa tacacactgg agagaaaccg tataagtgta      1140
     atgaatgtgg caaagccttt ggccggtggt cagctcttaa ccaacatcag agacttcaca      1200
     caggagaaaa acactatcac tgtaatgact gtggcaaagc ctttagtcag aaagcaggcc      1260
     tctttcacca tatcaagatc cacacaagag acaaacctta tcagtgcact cagtgtaata      1320
     aaagttttag tcggcgttcc atacttactc agcatcaagg agttcatacc ggcgccaagc      1380
     cgtatgagtg caacgagtgt ggaaaagcct ttgtttataa ctcatccctt gtttcccatc      1440
     aggaaatcca ccacaaagaa aaatgctatc agtgtaagga atgtgggaaa tccttcagtc      1500
     agagtggcct tattcagcat cagagaattc acactgggga aaaaccctac aaatgtgacg      1560
     tatgtgaaaa agcctttatt caaaggacaa gtcttacaga acatcagcga attcacactg      1620
     gagaaagacc ctataaatgt gataagtgtg ggaaggcgtt tactcaaaga tcagtcctca      1680
     cggaacatca gagaatccac actggagaga ggccctacaa gtgtgatgag tgtgggaatg      1740
     ccttccgagg aatcaccagc ctcattcagc atcagagaat ccacactggg gagaagccct      1800
     accaatgtga tgagtgtgga aaagccttca gacagaggaa gaagaccagc tacaaggaaa      1860
     tacttctgaa aaatcactct gaaccccaag ctggagtgaa tcttctcctg agctctctca      1920
     ttccagaatg gcaatcttgt ttcaggagag atctctaata gtgactgatg gtaaaggaag      1980
     aaggctgtgc ctagaacaaa gaatcaggct ggcaaagaaa tcacaggtct ttcctcaaac      2040
     tttaaattgc tactctctgg agatagctac ctggacttta cagagctgtc agaagacttg      2100
     ggaaggtttg ccagcattgg aaaaagccac ttggacttca cagagctgtc agaagactta      2160
     ggaagctttg ccagtagttc ctgagaccag aaatacatat tatgaagcag gtgctggaac      2220
     aggccctggc ccctacttgt gaagctgcag atatagatgg tgttactgag aaggaaacta      2280
     aggacttggc tccaaaacaa aacaaaacaa aatctggaga tgctgaattt tgttgggggg      2340
     aatgtctgta gaactgcaac atcaatgcag taagtgtagt aaaagcttta gtttatggtg      2400
     agtcattact cagcatcatg gagtccacga tgaagagaat ctcttttcaa tctgtgcaat      2460
     caacaagttt ttgaaaggct tttgtttata gtggaaccct cttttccccc tagaagaacc      2520
     accacaagga aaaatgctgt caccataagg aatgtgggaa agttttcagc cacatggcct      2580
     tatttgactt caaagaatcc acatgagaga gagactgcat aaatgtaata actgaggagg      2640
     cctttgttca gcaaagaaac cttatacaaa ctcgtataaa gaatgtagga agaccttcac      2700
     ccagaagcca ggactgactg tgcaccagag aatctgcaca ataaacctga tgaatgtgga      2760
     gatgcttgct tcagcattgg agaattcaca gtaaagggaa accctgccag tgtgatgagt      2820
     acggaaaagt cttcagaggt tggaacttgg gaaaaatcag tgagtgaatt catattagag      2880
     aggctcttat aaatgagagg attgtggaaa cttgtataga cagagatcag acctcaacaa      2940
     gggagcctcc acagtattga aaagttaata taattaatgt aagtgggcaa gttgtatggg      3000
     gaatgggtag tctaaattgc tcattttagc cagtaaaaac attaaattag tttcttagat      3060
     caagaaaagg aaatgttaga agttattttt cccttccaga ggggtctata tgtgtaagca      3120
     accaggactt ttgaaataag ttgcatctct ggatttgtga tctgtctcct ggatgattat      3180
     ctctgttttg ggagacaggt attttttctt catgcctgct ctagtctcat ctcatatctt      3240
     taattcattc agcaagtata cacaatagta ttatcgtcta ctgtttgttg taaatatata      3300
     tatattattt tctttttggt ctgagtaggc ttgtattggt accctaggac ataaaaatca      3360
     catatatcat gtttcagtaa atgcagtgaa aggaactata ttattaaatt gctgggaatt      3420
     tctgtaaatt tgagactacc tttatattct ccaacacaag accgtgtagg tgtcccttca      3480
     gagagtatat ttttctagct tggcttcttt attttcttta tttttttgag atggagtctt      3540
     gctcctgtcg cccaggctgg agtgcaatgg cacgatctcg gctcactgca acctccgcct      3600
     cccaggttca agtgattctc ctgtctcagt ctcccgagta gctgggatta caggcacttg      3660
     ccaccattcc cagctaattt ttgtattttt agtagagacg gggtttcacc atgttggcca      3720
     ggctggtctc gaactcctga ccttgtgatc tgcccacctt ggcctcccaa agttcaggga      3780
     ttacaggcat gagccaccat gcccggctgt tttttttaag atagaaaaat atacttcatg      3840
     tatagcctat tgacagataa tgactgatat tttttcttat agataacaca taataaacat      3900
     tgtgaagact aaaaaaaaaa aaaaaaaaaa a                                     3931
//

If you have problems or comments...

PBIL Back to PBIL home page