(data stored in ACNUC10243 zone)

EMBL: BC044442

ID   BC044442; SV 1; linear; mRNA; STD; VRT; 1646 BP.
XX
AC   BC044442;
XX
DT   24-JAN-2003 (Rel. 74, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Danio rerio heterogeneous nuclear ribonucleoprotein A1, mRNA (cDNA clone
DE   MGC:55638 IMAGE:3815200), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1646
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1646
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (17-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3361f66917f764063501b472aa6d5fdc.
DR   RFAM; RF00005; tRNA.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano and Dr. Ko-ichi Kawakami
CC   cDNA Library Preparation: Dr. Sumio Sugano and Dr. Ko-ichi Kawakami
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 102 Row: a Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 27882513.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /strain="AB"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano Kawakami zebrafish DRA"
FT                   /clone="MGC:55638 IMAGE:3815200"
FT                   /tissue_type="Whole body, adult, (one male and one female,
FT                   including unfertilized eggs)"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1646
FT                   /gene="hnrpa1"
FT   CDS_pept        67..1335
FT                   /codon_start=1
FT                   /gene="hnrpa1"
FT                   /product="heterogeneous nuclear ribonucleoprotein A1"
FT                   /db_xref="GOA:Q803K3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034803"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR037366"
FT                   /db_xref="UniProtKB/TrEMBL:Q803K3"
FT                   /db_xref="ZFIN:ZDB-GENE-030912-14"
FT                   /protein_id="AAH44442.1"
FT                   /translation="MHQSHRQACGVARTEIVGRMSKEGQPREPEQLRKLFIGGLSFETT
FT                   DDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVE
FT                   PKRAVSREDSSKPFAHTTVKKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGN
FT                   KRGFAFVTFDDHDSVDRIVIQKYHTVNGHNCEVRKALSKQEMANTGRGGGGGGGGGGGN
FT                   FNRYGNNGGYNNDFGGGGGGGNRDGYFGRGGRGNNFGGGGGGGGYGGGGDCYNNNNGFG
FT                   GGGYGGGGGNGGGSPGNYGGNRGYGGGGGGGHGYGNQGGGYGGGNSGGGGGGYNNYNNG
FT                   NGNFGGGNFGGGGGGGGNSGGGGNYNDFGNYNSQQSNYGPMKGNFGGGGRNSGPYGGGY
FT                   GGGSSGSGGGGSGYGGGSGGRRF"
XX
SQ   Sequence 1646 BP; 448 A; 286 C; 523 G; 389 T; 0 other;
     gcatttgtgg ttcagtggta gaattctcgc ctgccacgcg ggagacctgg gttcgtttcc        60
     cggccaatgc accagtctca ccgacaagcg tgtggcgtag cacggacaga aatagtcggt       120
     aggatgtcca aagagggcca gccacgtgag ccagagcagc tgcggaagct cttcattgga       180
     gggctcagct ttgagaccac agacgatagt ttaagggcac actttgaaca atggggcacc       240
     ttaacagatt gtgtggtgat gaaagatcca aacacaaagc gctccagggg ctttgggttt       300
     gttacttact ccagtgtgga tgaagtcaat gcctctatgg atgcacgtcc tcacaaggtc       360
     gatggtagac ttgtagagcc caaacgagcc gtgtctagag aggattccag caaaccattt       420
     gctcacacaa ctgtgaagaa gattttcgtg ggaggcatca aggatgatac agaggagaac       480
     catctacgcg actacttcga tcagtttgga aagattgagg ttgttgagat aatggttgac       540
     cacaagaccg gaaataaaag aggctttgcc ttcgtcacat ttgatgacca tgactctgtt       600
     gaccgtatcg tcattcaaaa gtaccacact gtgaatggac acaactgtga agtccgaaaa       660
     gctctttcaa aacaagaaat ggcaaacact ggtcgtggtg gtggtggtgg aggcggcggc       720
     ggtggaggaa acttcaaccg atatggcaat aatggtggct acaataatga ctttggaggt       780
     ggcggtggag gtggcaaccg tgatggatat tttggaagag gaggaagagg aaataacttt       840
     ggaggtggtg gtggcggcgg tggctatgga ggaggcggtg actgctacaa caacaacaat       900
     ggatttggag gaggtggcta cggcggtggt ggcggcaatg gtggtggcag tcctggcaac       960
     tatggaggca accgtggata tggaggaggc ggtggaggag gacatggtta tggcaaccag      1020
     ggaggaggct atggtggtgg caacagtggt ggcggtggtg gtggctataa taactacaac      1080
     aatggcaatg gaaactttgg aggtggtaac tttggaggtg gtggtggtgg tggcggcaac      1140
     agtggaggag gtggaaacta caatgacttc ggcaactata atagccagca gtccaactat      1200
     ggtcccatga aagggaactt tggaggcggt ggaagaaaca gtggcccata tggtggtggc      1260
     tatggaggtg gatctagtgg tagtggagga ggcggcagtg gttatggagg tggctctggc      1320
     ggtagacggt tttaagctta aaggactgag tgctttagga gaggagagcg agagaggtga      1380
     cagggcagat gcaggtttac gtccctagat ctgctcagcc aaacaggtgt ggcagattta      1440
     cagctgccac cagaagaagt gtacagtagc gctatcgtgt gtgggacatc atgaatttgt      1500
     catcatgcag atttatttta tattgtcttt ggggaaaagc attccaatga ggttttatgt      1560
     agagttcctt tcagttgttt ttatttatgt aaccaatcaa ggtgaaataa aaacatcatt      1620
     ttgttttttt aaaaaaaaaa aaaaaa                                           1646
//

If you have problems or comments...

PBIL Back to PBIL home page