(data stored in ACNUC3292 zone)

EMBL: BC046313

ID   BC046313; SV 1; linear; mRNA; STD; MUS; 3270 BP.
XX
AC   BC046313;
XX
DT   11-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus sperm associated antigen 1, mRNA (cDNA clone MGC:54631
DE   IMAGE:6310604), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3270
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3270
RA   Strausberg R.;
RT   ;
RL   Submitted (31-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; da86d94636a702394e37f632797ebe51.
DR   Ensembl-Gn; ENSMUSG00000037617; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021753; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021534; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022198; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021050; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021696; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021629; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022221; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020794; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021106; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000047348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171205; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040760; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040759; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041227; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040548; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040529; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040630; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041275; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040140; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039901; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: c Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3270
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:54631 IMAGE:6310604"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3270
FT                   /gene="Spag1"
FT                   /note="synonym: tpis"
FT   CDS_pept        235..2940
FT                   /codon_start=1
FT                   /product="Spag1 protein"
FT                   /db_xref="GOA:Q80ZX8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025986"
FT                   /db_xref="MGI:MGI:1349387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80ZX8"
FT                   /protein_id="AAH46313.1"
FT                   /translation="MTAKAKDCPSLWGFGTTKTFKIPIEHLDFKYIENCSDVKHLEKIL
FT                   YVLRSGEEGYYPELTEFCEKCLTNLAPKSRALRKDKPAETASSFSAEEWEKIDSDLKSW
FT                   VSEIKREENTCHFHDPENHPGVEDPLPPVRGSTCCPHSGKETYSKSKTAKKRIPRDYAE
FT                   WDKFDVEKECSKIDEDYKEKTVINNKAHLSKIETKIETAGLTEKEKSFLANREKGKGNE
FT                   AFYSGDYEEAVMYYTRSLSALPTAIAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVK
FT                   ALLRRATTYKHQNKLQEAVDDLRKVLQVEPDNDLAKKTLSEVERDLKNSEPVSELQTKG
FT                   KRMVIEEVENSGDEGGKGSADEREDGGSDEAAMGNIQKKLMVRRSEGGRRSRRGRTPGP
FT                   RAEQQGGLRETATASTGDSHYPEEPRAADNPSGLKRRGNELFRGGQFAEAAAQYSVAIA
FT                   QLEPTGSANADELSILYSNRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYE
FT                   TLEQYRNAYVDYKTVLQIDCGIQLASDSANRIARILTELDGSKWRERLPPIPAVPTSEP
FT                   LRVWLPAAETPDQDPCPNNCMPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKI
FT                   NSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKGLENCRESG
FT                   VDPSQVLLSPDSSEAARHLDTKNDTAPPSKGRERRRIQVQEVDGSSDEEPERPAEASAT
FT                   SAPARDGVEDGGSAEPAEKLDVSKPTNAYEFGQVLSTISARKDEEACAHLLAITAPKDL
FT                   PLLLSNKLEGDTFLLLIQSLKSHLVAKDPSLVYEHLLYLSKAERFKTMLTLINKGQKEQ
FT                   MAQLFDGLSDTQSDGLTAEDVQALRRQYEL"
FT   misc_feature    691..1170
FT                   /note="NrfG; Region: FOG: TPR repeat [General function
FT                   prediction only]"
FT   misc_feature    1657..1743
FT                   /note="TPR; Region: Tetratricopeptide repeats"
FT   misc_feature    2158..2253
FT                   /note="TPR; Region: Tetratricopeptide repeats"
XX
SQ   Sequence 3270 BP; 1014 A; 741 C; 854 G; 661 T; 0 other;
     cttcagcccc cagcccaagc cggaggaagg actccctgcg ccaaagcttg caggttggcc        60
     caagagctag ttcccaggct cgtcctagac actttacctg ggtctggcgg tgcctggaaa       120
     ccgttgccat ggctggggcg tgccacttcc gtttctggct gcagagggcg ccggctgcct       180
     gagtaggaga agctgagttt tcacgttact ggggttacca ggaaacgcta tgccatgact       240
     gctaaggcta aggactgtcc atcattgtgg ggctttggaa caacaaaaac atttaaaatt       300
     cccatcgaac atttggattt caagtatatt gaaaactgtt cagatgtgaa acacctggaa       360
     aaaattcttt atgtgctgag gtctggtgaa gaaggctact atcctgaact cacggaattt       420
     tgcgagaagt gcctcaccaa cttggctcct aaaagtcgag ctctgaggaa ggacaagcct       480
     gcagagacag catccagctt ttcagcggaa gagtgggaaa aaatcgacag tgatctaaag       540
     agttgggtgt cagaaatcaa aagagaggaa aatacatgtc acttccatga ccctgaaaac       600
     catcccggag tggaagatcc tctgcctcct gtccgcggct ccacctgctg ccctcacagt       660
     ggcaaggaaa catattctaa aagtaagaca gctaagaaga ggattccaag ggattatgca       720
     gaatgggata aatttgatgt ggaaaaagaa tgttcaaaga ttgatgagga ttacaaagaa       780
     aagactgtca taaacaacaa ggctcatctg tctaaaattg agacaaaaat agaaacagca       840
     ggtctgactg agaaggaaaa gagttttctt gccaatcgtg aaaagggaaa agggaacgag       900
     gctttctact ctggggacta tgaagaggcc gtgatgtatt acaccaggag cttatcagcc       960
     cttcccaccg ccattgccta taacaatcga gctcaggccg aaatcaagtt gcagagatgg      1020
     agcagtgctc ttgaagactg tgagaaggcc ttggagctag atcccggaaa cgtaaaagct      1080
     ctcctgagac gagccactac atataaacat caaaacaagc tccaggaagc tgtggacgac      1140
     ctgagaaagg tgctgcaggt ggagccggac aacgacttgg ccaagaagac cttatcagag      1200
     gttgaaagag atctgaagaa ttcagagcct gtctctgagc tccaaaccaa agggaagagg      1260
     atggttattg aagaagttga aaactcggga gatgaaggtg gaaagggaag cgcagatgag      1320
     cgtgaagatg gtggctcgga tgaggcggcc atgggcaaca ttcagaagaa gctgatggtc      1380
     cgccggagcg agggtggcag gcggtcgcgg cggggccgga caccggggcc ccgagctgag      1440
     cagcagggag gcctgcgaga gacagcgacg gccagcaccg gcgacagtca ctacccggag      1500
     gagccgcgag ccgctgacaa ccccagcggc ctcaagagac ggggcaacga gctgttccgc      1560
     ggcgggcaat tcgcagaggc agccgcgcaa tactcggtgg cgatagcgca gctggaaccc      1620
     acaggaagtg caaatgcgga tgagctaagc atcttgtatt caaatagagc ggcatgctac      1680
     ctcaaagaag ggaactgcag ggactgcatc caggattgta acagggctct ggaacttcat      1740
     ccgttctcag tgaagcctct tctgcggcga gcaatggcct atgagacctt agagcaatac      1800
     aggaacgcat atgtggacta taaaacagtg ctgcagatag attgtgggat ccagctggcg      1860
     agcgacagtg ctaacagaat agcacgaatc ttaacagagc tagatggatc aaaatggcgg      1920
     gagagactgc cacccatccc agctgtaccc acatctgagc cactgcgagt ttggctccct      1980
     gctgcagaga ccccagacca agatccctgt cccaacaact gcatgccgag catcacagat      2040
     gaaaaaatgt ttcaagccct caaggaagaa ggaaatcaac ttgtaaagga caaaaattat      2100
     aaagatgcca ttagtaaata caatgaatgc ttaaagatta acagcaaggc atgtgccatc      2160
     tatacaaaca gggctctctg ttacctgaag ctgggccagt ttgaagaggc aaagctggac      2220
     tgtgagcagg cgcttcagat agacggcgag aatgtgaaag ccagccacag actagcgctc      2280
     gcccagaaag gactcgagaa ctgccgggaa agcggggtgg accccagtca agtcctccta      2340
     agcccagatt ccagtgaagc cgcccggcac ctggacacta agaatgacac agcacctccc      2400
     agcaaaggaa gggagaggag gagaatccaa gtccaagagg tggatggcag cagtgatgag      2460
     gagcctgaga gacctgcaga ggcctctgct acctccgcac ctgccagaga tggtgtggaa      2520
     gatggagggt ctgcagaacc agcagaaaaa ctcgacgtct ccaagcctac taatgcctat      2580
     gagtttggac aggtcctaag cactatcagt gccaggaaag atgaagaggc ctgtgcacat      2640
     cttttagcca tcactgcacc caaagacctg ccactgttgc taagtaacaa acttgagggg      2700
     gacacgttcc tcctcctcat tcagtcactt aaaagtcacc ttgtggctaa agacccctcc      2760
     ctggtgtatg agcatctcct gtatctgagc aaagcagaga ggtttaagac gatgctgaca      2820
     ctaattaaca aaggccaaaa ggagcagatg gcgcagctgt ttgatggtct gtcagacaca      2880
     cagtccgacg gtttgacggc agaggatgta caggccctaa gaaggcagta tgagctttaa      2940
     cttggggttg ctgagttcaa gacagcaaac attgtgatgc agttgcatgg gtaaagccac      3000
     acccagaagg atccctgttt ggacatcaga tgttgtactt atttttatat ctagaacatg      3060
     tatattctat aatctgattt ttatttattg taaatattct cttctgtact agagccaaca      3120
     cctttatatt taataactat attcagaact tggcaaatta tactctagct tataatacat      3180
     tttcttttaa tgacctaccc attaaaaatt taaaatacaa aaaaaaaaaa aaaaaaaaaa      3240
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                                       3270
//

If you have problems or comments...

PBIL Back to PBIL home page