(data stored in ACNUC15260 zone)

EMBL: BC046590

ID   BC046590; SV 1; linear; mRNA; STD; MUS; 2687 BP.
XX
AC   BC046590;
XX
DT   13-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus olfactory receptor 77, mRNA (cDNA clone MGC:54867
DE   IMAGE:6309128), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2687
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2687
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e755d40e5927fb221a2d1e05ce1b9c58.
DR   Ensembl-Gn; ENSMUSG00000051118; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034404; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034384; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034311; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034088; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034897; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033413; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034062; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034219; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034163; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034304; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034918; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033117; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033528; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000057596; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217347; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091305; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091382; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091323; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091309; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090883; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091831; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091464; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090812; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090859; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091044; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092146; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090902; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089914; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: b Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328370.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2687
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:54867 IMAGE:6309128"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2687
FT                   /gene="Olfr77"
FT                   /note="synonyms: MOR143-1, 18A"
FT   CDS_pept        372..1310
FT                   /codon_start=1
FT                   /gene="Olfr77"
FT                   /product="olfactory receptor 77"
FT                   /db_xref="GOA:Q8VEY9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2153206"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEY9"
FT                   /protein_id="AAH46590.1"
FT                   /translation="MEAENHTAIVHFLLIGLSEDPKIQSVLFGLFLSMFLITMLGNFLI
FT                   VLVTSCDSHLHTPMYFFLCNLSFVDICLTSTTIPKMLVNIYMHTMKISYTECLTQVYFF
FT                   NNFLGMDNFLLTIMAYDRFVAICHPLNYTVIMNPRICGLLVLLSWIIMFWVSLIHMLLM
FT                   KQLNFSTSTEIPHFFCELTELLRVARSDTHINNIFLYLVTAVLGMFPVIGIAFSYFHIV
FT                   SALMKMSSIKNKYKAFSTCGSHLCVVSMFYGTGFVVHLSSAVAHSSKRNTITSIMYTVV
FT                   TPMLNPFIYSLRNKDVKGALVRLLRRVKFCP"
FT   misc_difference 1879
FT                   /gene="Olfr77"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2672..2687
FT                   /gene="Olfr77"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2687 BP; 799 A; 489 C; 375 G; 1024 T; 0 other;
     cactataaca ctatgaggtt gtagtctttg tatgatacaa gaactataaa tttcatagca        60
     ttctttctat gtcacaaaag tatagtttcc acaaaccctg tctatccaac tatcactatt       120
     tccttttccc atttttgaag tgtagaatat tttccaataa gaattattcc ctggaaaatc       180
     tctacttttt ccatccttta atacaagatt ttcttcgttt tggattgggg caacccagta       240
     agcataacga tgtttagttt aatggagaac tttctggatt ctcttcagat catacagatc       300
     tttgtctttt aatttcaaga acttattcag acactccttt ttttttaact ttcagaaaac       360
     aaaaaacctg catggaagca gagaaccata cagccatagt acatttcctc cttattggtc       420
     tttcagaaga tcctaaaatt caatctgttc tttttggact attcctatct atgttcctga       480
     ttaccatgct tggaaacttt ctcattgtct tagtcaccag ctgtgactcc caccttcaca       540
     cccccatgta ctttttcctc tgcaacctgt catttgttga catttgttta acctccacta       600
     ctatccccaa aatgttggtg aacatttaca tgcacaccat gaagatatcc tacacagagt       660
     gccttactca agtatatttt tttaataatt ttcttggaat ggataatttt ctactgacca       720
     ttatggccta tgatcgtttt gtggccatct gtcatccact taactacaca gtcatcatga       780
     accctcgaat ctgtggcctt ctggttcttt tatcttggat cattatgttc tgggtttcct       840
     tgattcatat gctgttgatg aaacaactga acttctctac tagcactgaa atcccacatt       900
     tcttttgtga actcactgag cttctcaggg tggcccgctc tgatacccac ataaataaca       960
     tttttctgta tttggttact gcagtgctag gtatgtttcc tgtcattggg atagctttct      1020
     cttattttca cattgtctct gctttaatga aaatgtcctc cattaagaat aagtataaag      1080
     ccttttccac ctgtgggtct cacctctgtg tggtatccat gttctatggg acaggatttg      1140
     tagttcatct cagttctgct gtagcccatt catccaagag aaacacaatc acttcaataa      1200
     tgtacactgt tgtcacccct atgttgaacc ccttcatcta tagcttgcga aacaaggatg      1260
     taaagggggc cttagtaaga ctccttagaa gagttaaatt ttgtccttga tgcattactg      1320
     ataccaaaga aagataatta ttgtgagtac caatattcaa agtcttttca tccctggatc      1380
     tttgaagttt ctactattct cattgttttg gttttgtgaa tatattaatt gatttctccc      1440
     taaataccaa tcaattatca tcttttaaca tttttttcca taaagtttat gaagaaatat      1500
     aaaagtttga cataaatttt atggactttt ctgatgtttt gaagtttatc tacagaatct      1560
     atgtaggaac taatctggtt ttcctcaaag tatattgctt aaggaaaggt gagatggttc      1620
     aacatgtgtg taaagagctt gcagctcttt taatataaac tcaataactg atatttgtgt      1680
     aaaagtggaa tcagagaatc aacttcacaa atttgtcctc tgaccttcac cagcacctta      1740
     tggcatgcac aggttcacac atatgtacac atacaataaa aattattttt ataatttaaa      1800
     ataaattgtt tgaatattac tattttcatc atagtttagg tacatttgta tcttcttatg      1860
     aaacaatgta agggaaatta ctgcagcaat atagctatca ctgtatcagg atacagtaat      1920
     tttcttcttt cttctttaaa catttaaatc tactcatatg gcaacatttc tttaagaatt      1980
     tttctctctt ttatgtaata tttgaaaaga aagtactaac ttgaaatgga cagctggaac      2040
     ttggcaatga ctacatgttc ataaggcata tattcactat cccaattttt gtaataacaa      2100
     ttgaattttg aatataaaga tagaaatttg aaagaatttt acccacctta cttttaatta      2160
     cttagtagct agagttattc tgaaacattg cttcattctt ttaaaacctt tgatcttttt      2220
     ctttttatct tatctcattt tctattttat gtttttgccc tcatttcctt tatccttatt      2280
     atcttctttc ctcttgttgt ttcattggtt ttcattaact aatcattatg tctatgaatg      2340
     agtatattag ttaatatatc aattttacac actgatgggc atgtcactaa tttctatgac      2400
     tttttattta taatatttaa atagatttgt ttcaatagta actatgctaa ctatgaacag      2460
     aataattaca tgaaggtgta tcagaatata tattgtctac tagaagtgat atctgtgttt      2520
     atgtatgtag catactctgc tctgtttgtt tatataatta taaaaatttt cttgtaatgc      2580
     atgtgacaaa caactgtcct tatcacacct tgattgtgat caattatttg gaaaaatgta      2640
     taagaataag agagttggct catatatata aaaaaaaaaa aaaaaaa                    2687
//

If you have problems or comments...

PBIL Back to PBIL home page