(data stored in ACNUC27125 zone)

EMBL: BC046617

ID   BC046617; SV 1; linear; mRNA; STD; MUS; 1864 BP.
XX
AC   BC046617;
XX
DT   24-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus protein phosphatase 3, catalytic subunit, gamma isoform, mRNA
DE   (cDNA clone IMAGE:6494240), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1864
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1864
RA   Strausberg R.;
RT   ;
RL   Submitted (10-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 7b5859c252ce25d8d2c97e3e2556143b.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: p Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679446.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1864
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="IMAGE:6494240"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..1617
FT                   /codon_start=1
FT                   /gene="Ppp3cc"
FT                   /product="Ppp3cc protein"
FT                   /db_xref="GOA:Q80XK0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107162"
FT                   /db_xref="UniProtKB/TrEMBL:Q80XK0"
FT                   /protein_id="AAH46617.1"
FT                   /translation="EGGGLRPAGRRSREETMSVRRPQFSTTERVIKAVPFPPTRRLTLK
FT                   EVFENGKPKMDLLKNHLVKEGRVEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVH
FT                   GQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNH
FT                   ECRHLTEYFTFKQECRIKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLE
FT                   DIRKLDRFSEPPAFGPVCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFL
FT                   QNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNV
FT                   MNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDEEMNVTDEEDHYI
FT                   SSCPKGATTGRKEVIKNKIRAIGKMARVFTVLREESENVLTLKGLTPTGTLPLGVLSGG
FT                   KQTIETAKQEAAEEREAIRGFTIAHRIRSFEEARGLDRINERMPPRKEASYHHDAGRMH
FT                   SHSHPPHPQASRRTDHGKKAL"
XX
SQ   Sequence 1864 BP; 554 A; 409 C; 434 G; 467 T; 0 other;
     gaaggcggcg gcttgcgtcc agcgggccgc cggagccggg aggagaccat gtccgtgagg        60
     cgccctcagt tctccacgac cgagcgcgtc atcaaagctg tcccctttcc tccaacccga       120
     cggctaactt tgaaggaagt ttttgagaat gggaaaccta aaatggatct tttgaaaaac       180
     catttagtaa aagaaggtcg ggtggaagag gaggtggcct taaagatcat caatgatggg       240
     gctgccatcc tgaagcagga gaagaccatg atagaggtgg aggctccgat cacagtgtgt       300
     ggtgatgttc atggacaatt ctttgacctg atgaagttgt ttgaagttgg gggatcacct       360
     agtaatactc gctacctctt cctgggtgac tatgtggaca gaggctattt cagtatagag       420
     tgtgtgctgt atctatggag cttaaagatt aaccatccta aaacattgtt tctgcttcga       480
     ggaaatcatg aatgcaggca tcttacagag tacttcacct tcaaacagga atgtcggatc       540
     aagtattcag agatggtgta cgatgcgtgc atgcacactt tcgactgtct tcctcttgct       600
     gccctcttaa accagcagtt tctctgtgta catggaggaa tgtctcctga aattacttgt       660
     ttagaggaca ttaggaaatt agataggttt tctgagcctc ctgcttttgg gccagtgtgt       720
     gacctgctgt ggtctgatcc cttagaggac tacggcagcg agaagaccct ggagcactat       780
     acccacaaca ctgtccgagg ctgctcctac ttcttcagtt accctgcagt ttgtgaattt       840
     ttacagaaca acagtttatt atcaataatc agagcccatg aagcccagga tgcggggtac       900
     cgaatgtata ggaagaacca agcaactggc tttccgtcac ttattacgat tttctctgcc       960
     cctaattacc tagatgtcta taacaataaa gctgcagtgt tgaagtatga aaacaatgtc      1020
     atgaacatca ggcagttcaa ctgttcccca cacccctact ggctcccaaa cttcatggat      1080
     gttttcacgt ggtctttgcc ttttgttgga gagaaagtga cagagatgct ggtcaatatt      1140
     ctcaacatat gctcggatga agaaatgaac gtaaccgatg aagaagatca ctacatttca      1200
     agctgtccaa aaggagctac tacaggtcga aaagaagtca tcaagaataa aatccgagcc      1260
     attgggaaaa tggcccgggt ctttacggtt cttcgggaag agagtgagaa tgtgctgacc      1320
     ctcaagggcc tcactcccac aggcacactc ccactggggg tcctctctgg aggaaagcag      1380
     accattgaga ctgccaaaca agaagccgca gaggagcggg aagccatcag aggttttaca      1440
     attgcacaca ggatccgaag ttttgaagaa gcccgaggtc tagaccgaat taatgagaga      1500
     atgccacccc gaaaagaggc ttcatatcat catgatgcag ggaggatgca ctcacactcg      1560
     catccgccac acccacaggc gtcaagaagg accgaccatg gaaagaaagc cctgtaatga      1620
     ctcagggccc tgtgcagcac agatgggtcc caaccctatg agcaaatcac atttatttat      1680
     actggaaatg aaacaggaac aactcaaaca acttaaactt ggaggtgcat ttgtaattca      1740
     gtcgcattta ttctgtaaga aaaatgacca ttttataaat tcttctaatt tatgttcaat      1800
     atatatatat atataaaata cttttgtttt gtttccaaaa aaaaaaaaaa aaaaaaaaaa      1860
     aaaa                                                                   1864
//

If you have problems or comments...

PBIL Back to PBIL home page