(data stored in ACNUC9306 zone)

EMBL: BC047109

ID   BC047109; SV 1; linear; mRNA; STD; HUM; 4412 BP.
XX
AC   BC047109;
XX
DT   24-FEB-2003 (Rel. 74, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens radixin, mRNA (cDNA clone MGC:48283 IMAGE:5284438), complete
DE   cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4412
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4412
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b215d9cbe151e5184cac1003e22cd813.
DR   Ensembl-Gn; ENSG00000137710; homo_sapiens.
DR   Ensembl-Tr; ENST00000528498; homo_sapiens.
DR   Ensembl-Tr; ENST00000528900; homo_sapiens.
DR   Ensembl-Tr; ENST00000530301; homo_sapiens.
DR   Ensembl-Tr; ENST00000530749; homo_sapiens.
DR   Ensembl-Tr; ENST00000544551; homo_sapiens.
DR   Ensembl-Tr; ENST00000645495; homo_sapiens.
DR   Ensembl-Tr; ENST00000647231; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
CC   cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
CC   Toshiyuki and Piero Carninci (RIKEN)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 91 Row: g Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 62244047.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4412
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_95"
FT                   /clone="MGC:48283 IMAGE:5284438"
FT                   /tissue_type="Brain, hippocampus"
FT                   /note="Vector: pBluescriptR"
FT                   /db_xref="taxon:9606"
FT   gene            1..4412
FT                   /gene="RDX"
FT   misc_difference 48
FT                   /gene="RDX"
FT                   /note="'C' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   CDS_pept        211..1962
FT                   /codon_start=1
FT                   /gene="RDX"
FT                   /product="radixin"
FT                   /db_xref="GOA:P35241"
FT                   /db_xref="H-InvDB:HIT000053090.15"
FT                   /db_xref="HGNC:HGNC:9944"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35241"
FT                   /protein_id="AAH47109.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFF
FT                   GLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL
FT                   QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKL
FT                   TKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
FT                   LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKEKREIAEKEKERI
FT                   EREKEELMERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEA
FT                   KSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEK
FT                   TKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTE
FT                   TQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQR
FT                   IDEFEAM"
FT   misc_difference 1045
FT                   /gene="RDX"
FT                   /note="'A' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
FT   misc_difference 1192
FT                   /gene="RDX"
FT                   /note="'G' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'E' in cDNA, 'K' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 2413
FT                   /gene="RDX"
FT                   /note="'G' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 2884^2885
FT                   /gene="RDX"
FT                   /note="1 base in the human genome, T, is not found in cDNA.
FT                   The chimpanzee genome agrees with the cDNA sequence,
FT                   suggesting that this difference is unlikely to be due to an
FT                   artifact."
FT   misc_difference 3244^3245
FT                   /gene="RDX"
FT                   /note="6 bases in the human genome, GTGTGT, are not found
FT                   in cDNA. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 3270..3273
FT                   /gene="RDX"
FT                   /note="4 bases in cDNA are not found in the human genome.
FT                   The chimpanzee genome agrees with the cDNA sequence,
FT                   suggesting that this difference is unlikely to be due to an
FT                   artifact."
FT   misc_difference 4379..4412
FT                   /gene="RDX"
FT                   /note="polyA tail: 34 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 4412 BP; 1471 A; 744 C; 897 G; 1300 T; 0 other;
     attgcggagc tgtctgcggt ggcggcggcg cctctcgtct cccgcggccc agcgctcgca        60
     ccaccgcttc tccctccctg tcgcagccgc gccgccgcgc agcgccccag ccacacgccg       120
     gcgggcagaa gccgcccgct ctccggaaag tgataacaga attcattgaa gtggagaatt       180
     tttaaagaag gtaacaaaaa gagaaagaaa atgccgaaac caatcaacgt aagagtaact       240
     acaatggatg ctgagctgga atttgccatt cagcccaata caactggcaa acaacttttt       300
     gaccaggtgg tgaaaacagt tggtttgcgt gaggtctggt tttttgggct gcagtatgta       360
     gacagcaaag gttattctac atggcttaaa ctaaataaaa aggtaacaca gcaggatgtt       420
     aaaaaagaga atcctttaca gttcaagttt agagctaaat tctttcctga agatgtttct       480
     gaggaattaa ttcaagaaat aacccagaga ctcttcttct tgcaagttaa agaagccatc       540
     ttaaatgatg agatatattg cccgccagaa actgcagttc ttttggcttc ctatgctgtc       600
     caagccaagt atggagatta caataaagag attcataagc caggctacct ggctaatgat       660
     agactcctac cccagcgtgt attggaacaa cacaaactaa caaaagaaca gtgggaagaa       720
     agaatacaga actggcatga agaacataga ggaatgttaa gggaggattc tatgatggaa       780
     tacctgaaga ttgcacaaga tctagaaatg tatggagtca actattttga aataaaaaat       840
     aaaaaaggaa ctgaattgtg gctaggtgtt gatgctttgg gtctgaatat ttatgagcat       900
     gacgacaagt taacacctaa aattggtttt ccctggagtg aaatcagaaa tatttcattt       960
     aatgacaaaa aatttgttat aaagccaatc gacaaaaagg cacctgattt tgtgttttat      1020
     gcacctcgtc tgagaatcaa taagaggatt ttggccttat gtatgggaaa ccatgaacta      1080
     tacatgcgaa gaaggaagcc tgatactatt gaagtacaac agatgaaggc tcaggctagg      1140
     gaggagaaac atcagaagca gttggaaagg gcacaattag agaatgaaaa ggagaaaaga      1200
     gaaatagcag aaaaggaaaa ggaaagaata gaacgtgaaa aggaagagct aatggaacgt      1260
     ctaaaacaaa ttgaagagca gacaattaaa gctcagaaag aactagaaga acagactcga      1320
     aaagctctag aactggatca agaacgaaaa cgagcaaaag aagaagcaga acgacttgaa      1380
     aaggagcgtc gagctgctga agaggcaaag tctgccatag caaaacaagc tgccgaccag      1440
     atgaagaatc aggagcagct agcagcagaa cttgctgaat tcactgccaa gattgcactt      1500
     ctagaggaag ccaagaagaa aaaggaagag gaagctactg agtggcaaca caaagctttt      1560
     gcagcccagg aagacttgga aaagaccaaa gaagagttaa aaactgtgat gtctgccccc      1620
     cctccacctc caccaccacc agtcattcct ccaacagaaa acgaacatga tgaacacgat      1680
     gagaataatg ctgaagctag tgctgaatta tcaaatgaag gggtaatgaa ccatagaagc      1740
     gaggaagaac gtgtaaccga aacacagaaa aatgagcgtg ttaagaagca acttcaggca      1800
     ttaagttcag aattagccca agccagagat gaaaccaaga aaacacaaaa tgatgttctt      1860
     catgctgaga atgttaaagc aggccgtgat aagtacaaga ctctgcgaca gattcgacaa      1920
     ggcaatacaa agcagcgtat cgatgagttt gaagcaatgt gagagctgtt attttgcata      1980
     tatgttcttc ataagctgaa ccaccaacag agaaaagcag gcctttgcag atatgatgga      2040
     atgcatccca ccttgccaaa gcacttacac cagtttgact gtgctagcta aaagacaaat      2100
     ttaaggggag ctcttcaaca ttaaggcagt atgatatcat gcttggtttt cttttttctt      2160
     ttggtccagg gaatggagaa tggtgttcca ttgcctcttt tcacattttt tttctttttc      2220
     tttttttttt ctgttgaaga ttaacactaa ttatcacgtc tgacaaatgt gtatgtgtgg      2280
     tttcagttct gtgtacattt taaaggataa tggtgaacat tttaatgggt ttcccttgcc      2340
     ctttccatat ttaacctatt tccacattct ctctcactca cattttctca gtgtgccctt      2400
     ctcttatctg ccgtgtccat agccataatt ccaccatcat acagatcagg cagtgtttaa      2460
     aatgatggta ggtagcacag tggacagtct ttgatcatca tgtagaatat ggctatgaat      2520
     caggaaagag attagaacat ttaataatgt atgtacagct ggtgcttagt ttttttttaa      2580
     tctaaattta attaccttat tggatatttg atatttggtt atttaatcac agtcatcttt      2640
     aacagcttac actgattggt gttttatctc ctgtgatcct ttgatggctt tttttgccta      2700
     ccatttcaca gaggtttaga cagcagtagt agctccctag gagagtttac tgatgaaaca      2760
     gcctctgcaa gattttaaaa gttttgttct tttatagact gatttagaaa aacaaatgat      2820
     tagttaaaaa aagaaaatat acatttgttg gtaactaatg ttatttttta aaacctggac      2880
     ctttctggaa gggcagcata taaaaacatc agtcccgagg aggggacaac aatactacct      2940
     cactactaca tctgtgatga ctggttgttc aaacacaatg gagtgtgtaa ggtatatgtt      3000
     ttataattca taaccatagc ctcgatcatc aagaaatact ttcgaaattt cattttcctt      3060
     cagaatatct taagagtgct aaatttttaa ctgccttttt gtcgagtcaa actgtgggat      3120
     tctgatttgt attaaaattg taagctcctc actggtatac tatcatcctg gaggggtgtt      3180
     gtatggctga gcaagagaga gagagaatga gagagagact gtgtgtgtgt gtgtgtgtgt      3240
     gtgtactctg tgtgtgtatg agagagagag agaaatgcta accttgtagc atgtgaagaa      3300
     tgtctgtacc ttgatacgat agttacataa tcagtatatt tggtttctag atcactgtgc      3360
     ttattttgtt tcaatctctg actaaaaata cttaaatttg gtttgttaat tcttatttta      3420
     gaaattataa ttttagttta tattaatttc ggttatagct tactgaagaa atctttccag      3480
     ttagaaggag gttctaatat tcacatgttc taatactttg tttattgtaa aacagctaaa      3540
     tttggagata cgtaaagcct tgttttctct gtgtggttca gctactttcc atttggtatt      3600
     acacagtcaa atttacattt atctattaaa attgccattt tattaaacat tttcatgcac      3660
     agtagattca agttgtgtct gaaaatatct cttgtgcttt tttgattttg ctgactttaa      3720
     aaggattaat ctgggcagac attatgtaaa agaaaggttg cgtttaatat attttttgaa      3780
     ctttgtagga caaaacatag ctggttaacc ttgaagtgac tgttgtacca tggttgtgca      3840
     catgcttcag aatcctatgg aagagaatat tcctacttgc agtacatcaa aggaatggat      3900
     ggtggaccct actattcatg ttttgagaca taaatgttca ctttaaagca attgcataat      3960
     agataaaaac ctgaactttc attggatttt tgttaatttt cctcattttg aattatgtgc      4020
     actaccatag ctacatcagt ttgatacagt attgaaaaat tatcagttat attttgctgt      4080
     ttatgatcta tttgtagatt aggattaaaa tggatttaat ccatttttaa ggctgtgtga      4140
     atttttctaa acaagaacca tttgcaatat ggatttctta gagattaaac caattataac      4200
     ttattagcag tcgcgagcac atgttcatat agtcaatgta aaaatacact aatgagtatt      4260
     tggtaaatcc cagtaggctt ttaccattag cataattttg tgttgtacaa ttaagttaca      4320
     attacatctc taattttgga taatattcat tggttaacaa taaagtgaca aaagctcaaa      4380
     aaaaaaaaaa aaaaagaaaa aaaaaaaaaa aa                                    4412
//

If you have problems or comments...

PBIL Back to PBIL home page