(data stored in ACNUC9306 zone)

EMBL: BC048181

ID   BC048181; SV 1; linear; mRNA; STD; MUS; 2914 BP.
XX
AC   BC048181;
XX
DT   25-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus ezrin, mRNA (cDNA clone MGC:61281 IMAGE:6826190), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2914
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2914
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; abc06f85f1cbb984c0d4bbabfec07321.
DR   Ensembl-Gn; ENSMUSG00000052397; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023085; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023532; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022364; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023555; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022111; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022418; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000064234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045456; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045407; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045889; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045056; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044852; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044534; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAV Plate: 130 Row: f Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678570.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2914
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="MGC:61281 IMAGE:6826190"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2914
FT                   /gene="Ezr"
FT                   /note="synonym: p81"
FT   CDS_pept        101..1861
FT                   /codon_start=1
FT                   /gene="Ezr"
FT                   /product="ezrin"
FT                   /db_xref="GOA:P26040"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:98931"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26040"
FT                   /protein_id="AAH48181.2"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKDGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQM
FT                   LREKEELMLRLQDYEQKTKRAEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRA
FT                   KEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVK
FT                   TKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNT
FT                   KQRIDEFEAM"
FT   misc_difference 2890..2914
FT                   /gene="Ezr"
FT                   /note="polyA tail: 25 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2914 BP; 811 A; 726 C; 798 G; 579 T; 0 other;
     cgcctgcagg tcccgacgcg tctccgccgt cgccgtcgcc gtcgcctccg ccgtacagcc        60
     gaatagccga ggacccacgc agagccacca accagccaag atgcccaagc caatcaacgt       120
     ccgggtgacc accatggatg ccgagctgga gtttgccatc cagccaaaca ccaccgggaa       180
     gcagctcttt gatcaggtgg taaagacgat tggcctccgg gaagtgtggt acttcggcct       240
     ccagtatgta gacaataaag gatttcctac ctggctgaaa cttgataaaa aggtctccgc       300
     acaggaggtc cgaaaggaga accctgtcca gtttaaattc cgggccaagt tctaccccga       360
     agacgtggcc gaggaactca tccaggacat cacacagaag ctcttcttcc tgcaagtcaa       420
     ggacgggatc ctcagcgacg agatctactg ccccccagag acagccgtgc tcctgggctc       480
     ctatgccgtt caggccaagt tcggagatta taacaaggaa atgcacaagt ctgggtacct       540
     cagctcggag cggctgatcc cccagagagt catggaccaa cacaagctca gcagggacca       600
     gtgggaggac cggatccagg tgtggcacgc ggaacaccga gggatgctca aggacagtgc       660
     tatgctagaa tacctgaaga ttgcccagga cctggaaatg tatgggatca actatttcga       720
     gatcaaaaac aagaaaggaa cagacctttg gcttggagtc gatgcccttg gacttaacat       780
     ttatgagaaa gatgacaagt tgaccccaaa gatcggcttc ccttggagtg agatcaggaa       840
     catctctttc aacgacaaga agtttgtcat taagcccatc gacaagaagg cacctgactt       900
     tgtgttctac gccccgcgcc tgagaattaa caagcggatc ctgcagctct gcatggggaa       960
     ccatgagctg tacatgcgcc gcaggaagcc cgacaccatc gaggtgcagc agatgaaggc      1020
     ccaggctcgg gaggagaagc accagaagca gctagagcga cagcagttgg aaaccgagaa      1080
     gaagaggcga gagacggtgg agagagaaaa ggagcagatg ctccgggaga aggaggagct      1140
     gatgcttcgg ctgcaggact acgagcagaa gaccaagagg gcggagaaag agctctccga      1200
     gcagattgag aaggccctcc aactggagga agagaggagg cgagcccagg aggaggctga      1260
     acgtctggag gccgaccgca tggccgccct gcgggccaag gaagaactcg agagacaggc      1320
     gcaggatcag ataaagagcc aggagcagct ggctgcagag ctggcagagt acacggccaa      1380
     gatcgcactg ctggaggagg cgcggaggcg caaggaggac gaggtagaag agtggcagca      1440
     ccgggctaaa gaagcccagg acgacctggt gaagaccaaa gaggagctgc acctggtgat      1500
     gacggcccca ccgcccccac cgcccccagt gtatgagcct gtgaattacc acgtgcagga      1560
     gggactgcag gacgagggag cagagcctat gggctacagt gccgagctct ccagtgaggg      1620
     catcctggat gaccgcaacg aggagaagcg gatcacagag gcagagaaga atgagcgcgt      1680
     gcagcggcag ctgctgaccc tgagcaatga gttgtcccag gcccgggatg agaacaagag      1740
     gacccacaat gacatcatcc acaacgagaa catgcggcaa ggcagggaca agtataagac      1800
     gctgcggcaa atcaggcagg gcaacaccaa gcaacgcatt gacgagttcg aggccatgta      1860
     gaggccaggc tgggaccaag ggcagagggc acctcactgc aggcaggtgt cacacttggc      1920
     tctttagttc tcttaagttt agacaccccc ttgctgtgtt ccagtccctt aaagagcagt      1980
     tacggggcct gcattctgcc ccgagaccca gtgggctcct ccttggttcc ttctaattgt      2040
     atcacatagt gccaaacagg tcagatttaa tgacagttac cgaatcactt cctgtttgga      2100
     gcagggattc ggagggctgg ccctcatgaa gcaagattca ttgtcactgg gacagcactg      2160
     tggctcacgg gtgccatact tttctctagt tttacaatga gctcaaatcg attttgttct      2220
     tgatttttat gaaggatcca tctctgtgta ttgaggggta aaaatgattt tgaaatttga      2280
     gtctaaagca tgcccccaca gagtctcctt cctccagacc gctggcagag tctccagggg      2340
     tccttcagag tgtacggtac aggactctcc gatacaaaat tctcatgctt atctgttagc      2400
     atacattgtt ggacttatat atctaatgat ctgctataga ggatagtatt tatatataag      2460
     cgataatatg ggtttgtaac attagtttta aaaaagggaa agttttgttc tgtatatttt      2520
     gttacctttt acagaataaa agaattcaac attaagaacc atgtaaccga gacacttgat      2580
     ctgacacagg ggcagtcggg aaaccgatga ctgcagtaat caccactgta caaaaatgtt      2640
     agtgggtttt gtgcacgtaa aatgcacact tccatttcct gtcagtttct tatttgaaaa      2700
     aaaaaaaata cacaccgaga gcatccagac tccagccctg aagggacgcc ggcctcttta      2760
     ttgtgagcaa cttgttcccg ttttcagttt gtcttccttc ctttcgcgga ctagcctcct      2820
     tggttgtgat gtctgtcctg tgcgggtgac tccgcaccag atttacacac aataaaagct      2880
     ctccaaggca aaaaaaaaaa aaaaaaaaaa aaaa                                  2914
//

If you have problems or comments...

PBIL Back to PBIL home page