(data stored in ACNUC32233 zone)

EMBL: BC048851

ID   BC048851; SV 1; linear; mRNA; STD; MUS; 3086 BP.
XX
AC   BC048851;
XX
DT   26-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus spectrin beta 3, mRNA (cDNA clone IMAGE:5135022), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3086
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3086
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a9cf22668c06ae7fc75857263c70a4ba.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 99 Row: i Column: 5.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3086
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="IMAGE:5135022"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..3086
FT                   /gene="Spnb3"
FT                   /note="synonym: mKIAA0302"
FT   CDS_pept        <1..2429
FT                   /codon_start=3
FT                   /gene="Spnb3"
FT                   /product="Spnb3 protein"
FT                   /db_xref="GOA:Q80ZK2"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1313261"
FT                   /db_xref="UniProtKB/TrEMBL:Q80ZK2"
FT                   /protein_id="AAH48851.1"
FT                   /translation="GKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQA
FT                   EVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAG
FT                   ERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDT
FT                   STIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYE
FT                   LQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQD
FT                   DGQRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELM
FT                   LWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHY
FT                   AAEEISEKLSQLQSRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRS
FT                   AELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQ
FT                   PPTSEPMASQPEGSLVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLEQQ
FT                   RLEQSNVPEGPGSGTGDESSGPRGERQTLPRGPAPSPMPQSRSSEAAHGATLPTRGPEL
FT                   SAQEQMEGMLCRKQEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVPYHGEV
FT                   PVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSA
FT                   PGESEEPVVPSASRGLTRAMTMPPVSQPEGSIVLRSKDGREREREKRFSFFKKNK"
FT   misc_difference 644
FT                   /gene="Spnb3"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 740
FT                   /gene="Spnb3"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2147
FT                   /gene="Spnb3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2897
FT                   /gene="Spnb3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 3054..3086
FT                   /gene="Spnb3"
FT                   /note="polyA tail: 33 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3086 BP; 782 A; 826 C; 920 G; 558 T; 0 other;
     ggggcaagcg gctggaggaa gctcttcgag cccagcaatt ctatcgtgat gctgcagagg        60
     ccgaggcttg gatgggtgag caggagttac acatgatggg ccaggaaaag gccaaggatg       120
     agctgagcgc ccaggcagaa gtgaagaagc atcaggtatt ggaacaagcc cttgctgact       180
     atgcccagac catcaaacaa ctagcagcca gcagtcaaga tatgattgac catgaacatc       240
     cagagagcac aagactaaca atacgccaag cccaggtgga caagctgtac gccagcctga       300
     aggagctggc aggagagcgg cgcgagcgcc tgcaggagca cctccggctg tgccagctcc       360
     gcagagagct ggatgacctg gaacagtgga tacaggagcg tgaagttgtg gcagcctccc       420
     atgaactggg ccaagactat gagcacgtga ctatgcttcg ggacaaattc cgagagttct       480
     ccaaggacac cagcaccatt ggccaggagc gcgtagacag tgccaatgca ctggccaatg       540
     ggctcattgc tgggggccat gctgcacggg ccactgtggc cgagtggaag gacagtctca       600
     atgaggcctg ggctgacctg ctggagctgc tggacacaag agggcaggtg ctggctgctg       660
     cgtatgagct gcagcgcttc ctgcatggag cccgccaagc cctggcacgg gtacagcaca       720
     agcagcagca gcttccagat gggactggcc gtgacctcaa tgctgctgag gccctgcagc       780
     gccggcactg tgcctatgag cacgacatcc aagccctcag cactcaggtc cagcaagttc       840
     aagatgatgg ccaaaggcta cagaaggcct atgctggaga caaggctgag gaaattggcc       900
     gtcacatgca ggcagtggct gaggcctggg cccagctcca gggaagttct gctgcccgcc       960
     gacagctgtt actggatacc acggacaaat tccgattctt taaggctgtc cgagagttga      1020
     tgctgtggat ggatgggatt aacctgcaga tggatgccca ggagcggccc cgggatgtgt      1080
     cctctgcaga tttagtcatc aaaaaccaac aaggaatcaa agcagagata gaggccagag      1140
     cagacaggtt ctcctcctgc attgacatgg ggcaggagct gctggcccgg agccactatg      1200
     ctgctgagga gatctcagag aagctgtctc agctacagtc ccggcgccag gagacagctg      1260
     acaagtggca ggagaagatg gactggctac agcttgtttt ggaggtgctt gtgtttggga      1320
     gagatgcagg gatggcggag gcctggctgt gcagtcagga gccattggtg cgaagtgcag      1380
     aactgggttg cactgtggac gaagtagaga gcctcatcaa gcgacacgaa gcctttcaga      1440
     agtcggccgt ggcctgggaa gagcgtttca gtgcgctgga gaagctcact gcgctggaag      1500
     agcgggaaaa tgagcggaaa aggaagaggg aggaggagga acggaggaaa cagcctccta      1560
     cttcagagcc catggctagt cagccagaag ggagtctggt agatggccag agagttcctg      1620
     acactgcctg ggatgggact cagtcaaaat tgccaccatc cacacaagca cccagtgtta      1680
     atggggtctg cacggacacc gactcctcac agcccctgtt ggaacagcag agacttgaac      1740
     agagcaatgt ccccgaagga cctggatctg gcacaggaga cgagtccagt gggccccggg      1800
     gagagaggca gaccctgccc cggggccctg ctccttctcc aatgccccag agcagatcat      1860
     ctgaagcagc tcatggtgcc accctgccca cacgaggacc tgagctctct gctcaggaac      1920
     agatggaagg gatgctgtgc cgcaaacaag agatggaagc cttcaacaag aaagctgcca      1980
     acaggtcatg gcagaatgtg tactgtgtac ttcggcgtgg gagcctcggc ttttacaagg      2040
     atgccagggc agctagtgca ggagtgccct accatggaga agtgcctgtc agcctggcca      2100
     gggcccaggg aagtgtggcc tttgattatc ggaaacgcaa acatgtcttc aagctgggct      2160
     tacaggatgg caaagaatac ctattccagg ccaaggacga ggcagagatg agctcatggc      2220
     tgagagtggt gaatgcagcc attgccactg catcctctgc ccctggagag tcagaagagc      2280
     cagtggtgcc cagtgccagc cggggtctga cccgggccat gaccatgccc ccagtgtcac      2340
     agcctgaggg ttccatcgtg cttcgaagca aggatggcag agaaagagag cgagaaaaac      2400
     gattcagctt ctttaagaag aacaagtagt cggggcaaga ctcccaggcc agctccctcc      2460
     ctctgttcag aaaactgcca gggactgtcg acagagacca ccctcttggc aggacaactg      2520
     cctgctgcta gggtctgctg ctaaggtcaa cccatcacca ggaactgtca ctggggacaa      2580
     aagagtgttc ccacaacctt ctcttctgct atttaattca actggtggtg ggacccaggc      2640
     tacccctaat accacccatt cctaccttgt cacctcttcc caagccttat acctccaccc      2700
     atccccccac catggtgcag atagtgccac cctcaacgtg ggctatgtgg gaaccattgt      2760
     ccctgcctca gggtcattgt gccaccacag ctagggtgtg ccatccacca ttcagttctt      2820
     tgcctctggg atcagccagg accctcagag ctgaagcagg caggacctga gggcaggagc      2880
     gccagatgat gaagtcagag gcgctgaagc cttccctgcc tatcctgcct caccctctga      2940
     ctcaaggggc tgcttgtttc cagccactct aggtggctcc caagtgtgag ttgttcagga      3000
     gtagccacat ccttgagcct atccaaggag gtgattaaac agctcgactt ctcaaaaaaa      3060
     aaaaaaaaaa aaaaaaaaaa aaaaaa                                           3086
//

If you have problems or comments...

PBIL Back to PBIL home page