(data stored in ACNUC22857 zone)

EMBL: BC049138

ID   BC049138; SV 1; linear; mRNA; STD; VRT; 3892 BP.
XX
AC   BC049138;
XX
DT   25-MAR-2003 (Rel. 75, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 11)
XX
DE   Danio rerio adaptor-related protein complex 2, beta 1 subunit, mRNA (cDNA
DE   clone MGC:55659 IMAGE:3815390), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-3892
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3892
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5a0f1eea7ea34ba761015da603db7cef.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano and Dr. Ko-ichi Kawakami
CC   cDNA Library Preparation: Dr. Sumio Sugano and Dr. Ko-ichi Kawakami
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 102 Row: b Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 29165685.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3892
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /strain="AB"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano Kawakami zebrafish DRA"
FT                   /clone="MGC:55659 IMAGE:3815390"
FT                   /tissue_type="Whole body, adult, (one male and one female,
FT                   including unfertilized eggs)"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..3892
FT                   /gene="ap2b1"
FT                   /note="synonyms: fa16e07, zgc:55659, wu:fa16c06,
FT                   wu:fc18c08, wu:fa16e07"
FT   CDS_pept        58..2913
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q7ZUF4"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ZUF4"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-6564"
FT                   /protein_id="AAH49138.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLL
FT                   KKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASHANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIQHGSIDTGESPVSTGPAASIDQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQIAAVDLLGGGLDSLLGGDLGGGVGGSPAVGQNFIPSSVPNTFAPS
FT                   PTPAALSSGLNDLFELSTGMATATGGYVAAKTVWLPAVKAKGLEISGTFSRRQGHMYMD
FT                   MTFTNKALQHMTDFAIQFNKNSFGVIPTTLLPVHTPLMPSQSIDISLPLNTIGPVMKMD
FT                   PLNNLQVAVKNNIDVFYFSTLIPLNVFFVEDGKMERQVFLATWKDIPNENELQYQIKDC
FT                   HLNADTVSGKLQSNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYVYQMYDATLKN"
XX
SQ   Sequence 3892 BP; 1042 A; 971 C; 906 G; 973 T; 0 other;
     attttgtaca tctggcgtcg attcttacat cgcttgtcca tttgagaagc tgtcagaatg        60
     actgactcaa agtatttcac caccaacaaa aaaggagaaa tctttgagct gaaggccgag       120
     ctgaataatg agaagaagga gaagaggaaa gaggcagtga agaaagtcat cgccgccatg       180
     acggtgggca aggatgtcag ttcgttgttt ccagatgtgg tgaactgcat gcagacggac       240
     aacctggagc tgaagaagct ggtttacctg taccttatga attatgccaa gagtcagccg       300
     gacatggcca tcatggcagt taacagcttt gtcaaggact gtgaggatcc aaaccctctg       360
     atccgtgctc tggctgtgcg cacgatgggt tgtatccgcg tggacaagat cactgagtac       420
     ctctgtgaac ctctgcgaaa gtgtctgaag gatgaagacc cgtacgtgag gaagactgca       480
     gccgtgtgtg tggccaaact gcatgacatc aatgctcaga tggtggagga ccagggcttc       540
     ctggactctc tccgggacct gatcgctgac tccaatccca tggttgtggc caatgcagtt       600
     gctgctctgt ctgagatcag cgagtctcac cccaacagca accttctgga cctgaaccct       660
     cagaacatca acaagcttct gacggctctt aatgagtgca ctgaatgggg ccagatcttc       720
     atcctggact gcctctccaa ctacaacccc aaagacgagc gggaggccca gagtatctgt       780
     gagcgggtga cgccacgtct ctcgcatgct aattcagctg tggtgctttc ggcggtaaag       840
     gtactgatga agtttttgga gctcctgccc aaagactctg attactacaa cactcttctg       900
     aagaagctct ctcctcccct cgtcacactg ttatctggcg aaccagaggt ccaatatgtg       960
     gcgctcagga atatcaacct tattgtgcag aaacggcctg agattttgaa gcaagagatt      1020
     aaagtgttct ttgtcaagta caatgatcct atatatgtca agttggagaa actggacatc      1080
     atgatccgac tagcctctca tgccaacatc gcccaggtcc tggctgagct gaaggaatat      1140
     gccactgagg tggatgtaga cttcgttcgg aaagccgtgc gagccattgg tcgctgtgcc      1200
     atcaaagtgg agcaatccgc tgagcgctgt gttagcaccc tgctggacct tatccagacc      1260
     aaagtcaact acgtcgtgca ggaagccatt gtggtcatca gggacatctt ccgcaaatat      1320
     cccaacaagt atgagagcat aatcgccact ctgtgtgaaa acctggactc tctggatgaa      1380
     cctgacgctc gaggagccat gatctggatt gttggcgaat atgcagagcg tatcgacaac      1440
     gctgatgagc tactggagag tttcctcgag ggcttccatg atgaaagcac tcaggtccag      1500
     ttgactctgc tgacagccat agtgaagctg ttcctgaaga agccctctga gactcaggag      1560
     ctggttcagc aggtgctcag tctggccact caggactctg ataaccctga cctgcgtgac      1620
     cgcggctaca tctattggcg tctgctgtcc actgatcctg tcaccgctaa agaggtggtg      1680
     ctgtctgaga aacctctgat ctcagaggag acggacctga ttgagcccac cctgctggac      1740
     gagctcatct gccacatcgg ctcgctggcc tctgtctacc acaagccccc aaatgccttt      1800
     gtggagggaa gccatggcat tcatcgcaaa catctgccca tccagcacgg cagtatcgac      1860
     accggggaga gtcccgtcag taccggcccg gctgcttcca ttgatcaacc ccaggtcatc      1920
     ccatctcagg gtgaccttct gggagacctg cttaatctgg acctcgggcc accggtcaat      1980
     gtgccccagg tgtcctccat gcagatagcg gctgtggatc tcctgggagg tggtcttgac      2040
     agtttgctcg ggggagatct gggaggaggt gttgggggca gtcctgcagt gggccagaac      2100
     ttcatcccat catcggtgcc caacaccttt gcaccatctc cgacacctgc cgctcttagc      2160
     agcggactca atgacctgtt tgagttgtcc acaggaatgg ccactgctac aggaggatat      2220
     gtggctgcta aaactgtgtg gctgccagca gtcaaggcca aaggactgga gatttctgga      2280
     accttctctc ggcgtcaagg gcacatgtat atggacatga ccttcaccaa taaagcattg      2340
     cagcatatga ctgactttgc catccagttc aacaagaaca gttttggtgt aatccccacc      2400
     acacttctcc ccgtccacac tccactgatg cccagtcaga gcatcgacat ctccctcccg      2460
     ctcaacacca tcggccctgt gatgaaaatg gatccactca acaacctaca ggtggccgtg      2520
     aaaaacaata ttgatgtctt ctacttcagc acgctgatcc ctctcaatgt cttcttcgtg      2580
     gaggatggca aaatggagcg tcaggtgttc ttggccacat ggaaggacat tcctaatgag      2640
     aatgagctgc aataccagat caaagactgc cacttaaacg cagatacggt gtcgggcaaa      2700
     ctgcagagca acaatgtcta caccatcgca aagaggaacg tggaaggcca ggacatgttg      2760
     taccagtcgc tcaaactcac caacgggatc tggattctcg ccgagctccg catacaacct      2820
     ggcaatccca attacacgct gtctctgaag tgcagggctc cagaggtttc tcagtacgtg      2880
     taccagatgt acgatgccac tctgaagaac tgagcgtctc tcttgtcctt tttcttcctc      2940
     tacacacacc tcttcttccc cagccgccgc caccaccggc atagaatcct gctctccaat      3000
     gattttctgc cgttgttttc catccatagg taccagtttt actcgatgtg ccctgcaaag      3060
     ttctgttctt gccaaatgtc tcgatgtggt tgaaaaaaaa gtggggattt ggcaacacag      3120
     ctcccatgtg atttctatcg ttcttttcaa ttgtttgaat gcgttcacct tcacatgcca      3180
     ttatcatgta cgaacaggaa aaaaacgtgc gtggaatatt tagaaacgta atgcgagtgt      3240
     attttcattt caagaccact atatcccgat gttagccaaa atgaaaacgc ttaatagtac      3300
     atgctagcta tctgatagta gcctcgcatg ctttttgacc aatataaaaa aaacgtcaca      3360
     ttcctttttt taacatttcg tgtaatcgtt caccaacatg tcaacactcc atcaacgtct      3420
     ccgatggttt caactgctat aaatcaacct aacgtgaagc agaaaaccga ctttctatcg      3480
     attgatcttg tgtaagtggg tcatctgata ttcattccca gattgagtcc attcatttgt      3540
     gatatatcgt gcttgtgaga tttgtgcatt aatattttgg tccctttggt gtaacgttct      3600
     acattaatac ataaaacatc gctcagcttt tggtttaaaa ctaatacact aatgtaggga      3660
     tgcaatatat tctaaataga catcaataat atccgatgaa atagatggat cactttatta      3720
     gtctttcagg tggtgctggt gatttaaatg tgaatgtttt gttgctaatg tgcctgtgtg      3780
     aacctgcatg tgagcagcgt ctaataaaca tctgccagta gaaaaaaaaa aaaaaaaaaa      3840
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa              3892
//

If you have problems or comments...

PBIL Back to PBIL home page