(data stored in ACNUC16935 zone)

EMBL: BC049473

ID   BC049473; SV 1; linear; mRNA; STD; VRT; 1634 BP.
XX
AC   BC049473;
XX
DT   09-APR-2003 (Rel. 75, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Danio rerio zgc:172187, mRNA (cDNA clone IMAGE:5913895), partial cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1634
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1634
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cd3800f12d44e65b9d6f1dc988831619.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 104 Row: i Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 47682710.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1634
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano SJD adult male"
FT                   /clone="IMAGE:5913895"
FT                   /tissue_type="Whole body, adult male"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            <1..1634
FT                   /gene="zgc:172187"
FT                   /note="synonyms: Ubi-p63E, ubc, zUBC, im:6892314"
FT   CDS_pept        <1..1443
FT                   /codon_start=1
FT                   /gene="zgc:172187"
FT                   /product="zgc:172187 protein"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ZU63"
FT                   /protein_id="AAH49473.1"
FT                   /translation="RFFEEEDQFQESYCSVSTQTLTMQIFVKTLAGKTITLEVEPSDTI
FT                   ENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK
FT                   TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES
FT                   TLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGK
FT                   QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQ
FT                   DKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
FT                   LEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
FT                   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
FT                   SDYNIQKESTLHLVLRLRGGSD"
XX
SQ   Sequence 1634 BP; 502 A; 415 C; 366 G; 351 T; 0 other;
     agatttttcg aagaagaaga tcagtttcag gagtcgtact gttccgtttc aacgcaaaca        60
     ttaacgatgc agatctttgt caaaaccctt gctggtaaga ccatcaccct cgaggtagag       120
     ccaagtgaca ccattgagaa cgtcaaggcc aaaatccaag acaaagaagg cattccccct       180
     gaccagcaga ggttgatctt tgctggcaaa cagctagaag atggccgcac cctgtccgac       240
     tacaacatcc agaaagagtc caccttgcat ctggtgctgc gtcttagagg aggcatgcag       300
     atctttgtaa aaaccttgac aggaaagacc atcaccctcg aggtagagcc aagcgacacc       360
     atcgagaatg tcaaggccaa aatccaagac aaagaaggca ttccccctga ccagcagagg       420
     ttgatctttg ctggcaaaca gctagaagat ggccgcaccc tgtctgacta caacatccag       480
     aaagagtcca ccttgcatct ggtgttgcgt ctcaggggag gcatgcagat ctttgttaag       540
     accttgacag gaaagaccat caccctcgag gtagagccaa gtgacaccat tgagaacgtc       600
     aaggccaaaa tccaagacaa agaaggcatt ccccctgacc agcagaggtt gatctttgct       660
     ggcaaacagc tagaagatgg ccgcaccctg tccgactaca acatccagaa agagtccacc       720
     ttgcatctgg tgctgcgtct tagaggaggc atgcagatct ttgtaaaaac cttgacagga       780
     aagaccatca ccctcgaggt agagccaagc gacaccattg agaacgtcaa ggccaaaatc       840
     caagacaaag aaggcattcc ccctgaccag cagaggttga tctttgccgg caaacagcta       900
     gaagatggcc gcaccctgtc tgactacaac atccagaaag agtccacctt gcatctggtg       960
     ctgcgtctca ggggaggcat gcagatcttc gttaagacct tgacaggaaa gaccataact      1020
     ctcgaggtag agccaagtga caccattgag aacgtcaagg ccaaaatcca ggacaaagaa      1080
     ggcattcccc ctgaccagca gaggttgatc tttgctggaa aacagctaga agatggacgc      1140
     accctgtccg actacaacat ccagaaagag tccaccttgc atctggtgtt gcgtctcagg      1200
     ggaggcatgc agattttcgt taaaaccttg acaggaaaga ccatcaccct cgaggtagag      1260
     ccaagtgaca ccattgagaa cgtcaaggcc aaaatccaag acaaagaagg cattccccct      1320
     gaccagcaga ggttgatctt tgctggtaaa cagctagaag atggccgcac cttgtctgat      1380
     tacaacatcc agaaagagtc tactttgcac cttgtgctgc gtctccgagg aggctcagat      1440
     tagaaccgac agtcttaggg atggacatta aattctcagt atcccctgct tatgcactca      1500
     ccactttttc ccattatttt attcatgttg tgttgctaaa tccaactaca ttcgtattac      1560
     catgttcttt catttgtttt tttttatctc agctgtcaaa ataaaagcat tgaaatcaaa      1620
     aaaaaaaaaa aaaa                                                        1634
//

If you have problems or comments...

PBIL Back to PBIL home page