(data stored in ACNUC10243 zone)

EMBL: BC050513

ID   BC050513; SV 1; linear; mRNA; STD; VRT; 1462 BP.
XX
AC   BC050513;
XX
DT   23-APR-2003 (Rel. 75, Created)
DT   28-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Danio rerio heterogeneous nuclear ribonucleoprotein A0, like, mRNA (cDNA
DE   clone MGC:56281 IMAGE:5602478), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1462
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1462
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 87830b54af935e83e1d37c3e59c8c28f.
DR   Ensembl-Gn; ENSDARG00000036161; danio_rerio.
DR   Ensembl-Gn; ENSDARG00000114889; danio_rerio.
DR   Ensembl-Tr; ENSDART00000052511; danio_rerio.
DR   Ensembl-Tr; ENSDART00000182776; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 103 Row: n Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40850962.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1462
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano SJD adult male"
FT                   /clone="MGC:56281 IMAGE:5602478"
FT                   /tissue_type="Whole body, adult male"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1462
FT                   /gene="hnrpa0l"
FT                   /note="synonyms: wu:fb38a07, fb38a07, wu:fb82e07"
FT   CDS_pept        61..969
FT                   /codon_start=1
FT                   /gene="hnrpa0l"
FT                   /product="hnrpa0l protein"
FT                   /db_xref="GOA:Q7ZU48"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034801"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ZU48"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-618"
FT                   /protein_id="AAH50513.2"
FT                   /translation="MTNQLCKLFVGGLNVQTTDEGLRAHFEQYGQLTDCVVVMNQPLQR
FT                   SRCFGFVTYSSTEEADAAMSARPHIVDGNNVDLKRAVAREDAGKPEMLAKVKKIFVGGL
FT                   KDDIEDEHLQDYFSQFGPIEKAQVITDKDTGKKRGFGFVYFDDNDSADKAVVMKFHSIC
FT                   GHKVEVKKALTKQEMQSTGGGRGGRGGRGMGRGSGFGGGGRGGYYNDYGYQNNGFGNNS
FT                   GYDSQNGYGGGYSDQMGGGYGNGNGYSDFGEGYGQQASGYGAMKTGYGNYSSGRQSSGP
FT                   YPRGGGGGGSGGYGRGGYGGY"
XX
SQ   Sequence 1462 BP; 388 A; 313 C; 396 G; 365 T; 0 other;
     aaacgcgttg ctttctttct tccgtcgagc gtgatccacc agtacgtcca ttgtgagaaa        60
     atgactaacc aactctgtaa actcttcgtc ggcggcttga acgtccaaac aaccgatgaa       120
     ggcttgcggg cacatttcga gcaatatgga cagctaaccg actgcgtggt ggtgatgaac       180
     cagccgctac agcgctccag gtgcttcggc tttgtaacat actcgagcac cgaggaagcg       240
     gacgccgcca tgtctgctag gcctcatatc gtagacggca acaacgtgga tctgaagcga       300
     gcggtggccc gggaagacgc cggtaaaccg gagatgctcg ctaaggtcaa gaaaatattc       360
     gttggtggac tgaaagacga catcgaggac gaacaccttc aagattattt ctcacagttt       420
     gggcccatcg agaaggcgca ggtcatcacc gacaaagaca ccgggaagaa gcgaggcttc       480
     ggctttgttt acttcgacga caacgattct gccgacaaag ccgtcgtgat gaagttccac       540
     tccatctgcg gacacaaggt ggaggtgaag aaagcgctca ctaagcagga gatgcagtcc       600
     accggtggcg gtcgcggcgg cagaggaggc cgaggaatgg gccggggaag cggctttggt       660
     ggcggcggaa gagggggtta ctataacgac tacggctacc agaacaacgg cttcggcaac       720
     aattccggct acgacagtca aaacggctac ggaggcggtt atagtgacca gatgggcggt       780
     ggatacggca acgggaatgg ctacagtgat ttcggcgagg gttatggaca gcaggcttcg       840
     ggctacggcg ctatgaaaac gggctacggg aattattctt ccggtaggca gagcagtggg       900
     ccgtacccac gtgggggagg aggcggcggt agtggcggct acggaagagg aggatatgga       960
     ggctattaga agcactaatg tgactctaag ctgcgttttt acttttattt ttttaagcaa      1020
     actatttgga ctctggactt tcaaaatatt cggtattggt ttaaataaga gcatcgttct      1080
     gtgccattac cagtaccagc agacacgcgt tgcgtttctt ttctttgttt cggttttagg      1140
     tggtcatgtg ttacccaagt caagcctgta aaacaccagt gtaggctttt gtgtgatctg      1200
     tttctaggtt tattgcctgt ccattgtttg gagacgaaac tcaggggtaa taatgaaatt      1260
     taagcagctc gttttcatcg tgacctccta atattctttg ttttttgagt gtaatataat      1320
     ttttgtttta atgctgtcac accgttccta ttgtacaact gttttaaagt ttttcatttg      1380
     atctgaaagt tgccatacgc cttttgacca ttaaaaaaca atctttttca taaaaaaaaa      1440
     aaaaaaaaaa aaaaaaaaaa aa                                               1462
//

If you have problems or comments...

PBIL Back to PBIL home page