(data stored in ACNUC1829 zone)

EMBL: BC052503

ID   BC052503; SV 1; linear; mRNA; STD; MUS; 1426 BP.
XX
AC   BC052503;
XX
DT   21-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus tetraspanin 9, mRNA (cDNA clone MGC:62968 IMAGE:5146854),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1426
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1426
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (16-MAY-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 42e75274510924f6de608c08d7676baa.
DR   Ensembl-Gn; ENSMUSG00000030352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031318; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031289; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031296; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031020; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030401; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030981; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031137; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031086; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030486; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112173; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080321; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080400; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080322; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080337; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080804; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080536; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079912; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080069; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080107; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079966; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079053; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 113 Row: l Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31341828.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1426
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu33"
FT                   /clone="MGC:62968 IMAGE:5146854"
FT                   /tissue_type="Lung, 2 pooled mouse tumors."
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..1426
FT                   /gene="Tspan9"
FT   misc_difference 3..4
FT                   /gene="Tspan9"
FT                   /note="in the mouse genome : TG."
FT   misc_difference 7
FT                   /gene="Tspan9"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 9
FT                   /gene="Tspan9"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS_pept        165..884
FT                   /codon_start=1
FT                   /gene="Tspan9"
FT                   /product="tetraspanin 9"
FT                   /db_xref="GOA:Q8BJU2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1924558"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJU2"
FT                   /protein_id="AAH52503.1"
FT                   /translation="MARGCLCCLKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWRTGCYEKVKLWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
FT   misc_difference 248
FT                   /gene="Tspan9"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 269
FT                   /gene="Tspan9"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 449
FT                   /gene="Tspan9"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1167
FT                   /gene="Tspan9"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1169
FT                   /gene="Tspan9"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1341
FT                   /gene="Tspan9"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 1407..1426
FT                   /gene="Tspan9"
FT                   /note="polyA tail: 20 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1426 BP; 313 A; 404 C; 402 G; 307 T; 0 other;
     ggcacgaggg ggagcggagc cggggcgcca caccgagtcc aagcgcgcgt tgcagctggc        60
     gaagacttgg gaagtcagat ccaagctgtc ccctctcaga ggagagtgag aggatccagc       120
     tcaggtgacc caggcaggca gtcagagaat ttaagaagtg caacatggcc aggggctgtc       180
     tctgctgctt gaagtacacg atgttcctct tcaatttgat attctggctc tgtggctgtg       240
     ggctgctcgg agtgggcatc tggctctccg tgtcccaagg caacttcgcc accttctccc       300
     ccagcttccc ctcactgtcc gcagccaacc tcgtcatcgc catcggcacc atcgtcatgg       360
     tgacgggctt cctgggctgc ctgggggcca tcaaggagaa caagtgtctg cttctcagct       420
     tcttcatcgt gctgttgatc atcctgctag cagagttgat tctgatcatc ctcttcttcg       480
     tctacatgga caaggtgaac gagaatgcca agcaggacct gaaagagggg ctgctgctct       540
     acaacacaga gaacaacgtg gggctcaaga acgcctggaa catcatccag gccgagatgc       600
     ggtgttgtgg ggtcactgac tacacagact ggtatccggt gctcggggag aacacagttc       660
     ctgacagatg ctgcatggag aattcccagg gctgtgggcg caacagcacc acccccttgt       720
     ggagaacggg ctgctacgaa aaagtgaagc tgtggtttga tgacaacaag cacgtgctag       780
     gcaccgtggg catgtgcatc ctcatcatgc agatcctggg aatggccttt tccatgacac       840
     tgttccagca catccaccgg acaggtaaaa agtacgacgc ctgaggctgc ggcagcgcct       900
     ggctccaccc ggacactgcg tgtgccaggg aagaggaccc gagtcatgtc tcctgcctgc       960
     tctccgatgg ccaccctgca ccacctgccg gcctgccctc ccctgcccac atccttggcc      1020
     ttagacctca tggagggcag aggcccaggg atgaggcatc atgcagagac ctcagggctt      1080
     gggcaactgg attcctgcac ctgcagactt gccaaagatg ccggggcggg cagggtgtca      1140
     gcgaggaagc cccttcaacg atgggttttt gcccctggcc ttcctcacac tgacacttgt      1200
     tcctatgtgg ggtggagagt ctgccccatg gaggccactg ccgtccatgg ctgcccagcc      1260
     agagagcctg ccagggtgca gtgtggcacc gccaggtcag gccccctgga gcaccctgcc      1320
     cgggttttta tactatagtg ataacttttt tttttatttt actctgatta tgattattca      1380
     ggaatattat ctctcagata agtttaaaaa aaaaaaaaaa aaaaaa                     1426
//

If you have problems or comments...

PBIL Back to PBIL home page