(data stored in ACNUC31108 zone)

EMBL: BC054586

ID   BC054586; SV 1; linear; mRNA; STD; VRT; 3040 BP.
XX
AC   BC054586;
XX
DT   05-JUL-2003 (Rel. 76, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 8)
XX
DE   Danio rerio CD82 antigen, mRNA (cDNA clone MGC:63984 IMAGE:6792470),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-3040
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3040
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7643d29affed0519ec6e594a599f7c3c.
DR   Ensembl-Gn; ENSDARG00000026070; danio_rerio.
DR   Ensembl-Tr; ENSDART00000147886; danio_rerio.
DR   Ensembl-Tr; ENSDART00000193808; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Leonard I. Zon, M.D.
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 117 Row: f Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 32451651.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3040
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZKid1"
FT                   /clone="MGC:63984 IMAGE:6792470"
FT                   /tissue_type="Kidney, zebrafish"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            1..3040
FT                   /gene="cd82"
FT                   /note="synonyms: wu:fc19g11, fc19g11, kai1"
FT   CDS_pept        108..878
FT                   /codon_start=1
FT                   /gene="cd82"
FT                   /product="CD82 antigen"
FT                   /db_xref="GOA:Q7T2E0"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7T2E0"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-2857"
FT                   /protein_id="AAH54586.1"
FT                   /translation="MGKGCIAATKYFLFLFNLLFFILGAVIMGFGLWVRLDSQSFLTVL
FT                   QESSTSLKVGAYILIGIGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLLLILIAQVTAAV
FT                   LIYFQRDLLKGETYNIVNKILVNYTGSNNTSEDAWDYIQRTMKCCGWSGQSDWKENVMI
FT                   KNNSKILYPCSCRNESISGSDKQEKGFCEGLSPQWPVFTKGCISSLEDWILRNCGVILG
FT                   VCVGIAVIELLGMILSMCLCKSVQQEDYTKVPKY"
XX
SQ   Sequence 3040 BP; 882 A; 544 C; 634 G; 980 T; 0 other;
     gtgagctgct ctctttttgt tcagactgtt agtagcacaa cagcgaacta actgacagct        60
     gctccacgga tcttcgctgc gacttgacac aaaatagagc tgcaatcatg gggaaaggat       120
     gcatcgccgc caccaaatac ttcctgttct tgttcaacct cctcttcttt attcttggag       180
     ctgtaatcat gggctttgga ctgtgggtca ggctggatag tcagagtttc ctcacggttt       240
     tgcaagagtc ttctacatcg ctgaaagttg gagcctacat cttaattggg attggatctc       300
     tgtctatgct catgggattc ctgggttgca ttggtgccat ttatgagatc cgctgccttc       360
     ttggattgta tttcacgtgc ctgctcctca tcctcatcgc tcaggtcaca gccgctgttc       420
     tcatctactt ccagagagac ctactgaaag gagagacgta caacattgtg aacaaaattc       480
     tggtgaacta cactggttct aacaatacat cagaggatgc ctgggattac attcagagaa       540
     cgatgaagtg ctgtggatgg agtggacagt ctgactggaa agagaatgtg atgataaaga       600
     acaactccaa gattctgtat ccatgttcct gcagaaatga atccatcagt ggctcagata       660
     agcaagaaaa aggcttttgt gagggtttgt cccctcaatg gcctgtcttc actaagggct       720
     gtatatctag tttggaggac tggatcctaa ggaactgtgg agttattctg ggtgtctgtg       780
     ttggaatagc agtgatcgag cttttaggga tgatcctgtc catgtgcctc tgcaagagtg       840
     tccaacaaga ggattacacc aaagtcccca aatactgagc gcaaaccccc atcacagaac       900
     aaaacagcag tgttacagcc tctccacacc agcacagcaa ctggaacaaa gcggaccaga       960
     ccagacacac aaacacttta atatcccatc aaacaatcca gtcatcaccc tgtccaacat      1020
     caacatttta taacagggct cctcttcttt taaagagaca ctccactttt tttgcaaata      1080
     ggcttatttt ttagctccac cagagttaaa gattgacatc cattcagtcg atttctgggt      1140
     ttggcgggag cacttttggc ttagcttagc ttagcataaa tcattgaatc ggattggacc      1200
     attagcatct tgctcaaatt caaaaaaaga gttcagataa ttttcttatt taaagcttgg      1260
     ctcttatgta gtaaattact tagctaggga ctattttcag gcactacata atatcatagt      1320
     gcctgcagca gccatggtag ggcagcaaag ttccttgatt attacatcat aatcggtatg      1380
     gtaaagtact atagtaaagg tatagtttct agacatatca acctaaaaat agaaacttta      1440
     cattttccgt aagcttttgt aactacagaa aactccagct tgaaatgaaa ttgaaatttt      1500
     tattgagtgg aatgctaatg gtctagtccg aatcgatgat ttatgctaag ctgagctaaa      1560
     ggtgctgccg ccagactcag ggttcagctg aatggattaa aaaatgatac aacttggctg      1620
     tttaactcta gaaggtgctg taaaatgagc tgatttccaa acaaaaaagt ggggtgttcc      1680
     tttaaatcgt aaataaataa attgatcttt tttaagtgct tttgggagtc tttatagcat      1740
     gatgtatgat tattatggct gtacttaact gttgcgttta ccattttcat tgttagttga      1800
     atttaagaga gcactttagt gaatagagag tttgataagg gagctacttt taaaatattt      1860
     ctttttattg aaaaaacaag gggaaacttc acactttttt attgacccta ctcttttttt      1920
     tatatatata tatatatgtt ttatatgaaa attgtatact ttcaatttgg ttatgtatat      1980
     atcaatatga ttgattgata tacttcagtc agggttgttc ttactgaata actacattcc      2040
     tcttatagca gcacttaatg attgctttct gtgtgtgtta ttagtcaggg tggagcaggt      2100
     gtggtttggg ttgggtaagg atgcctgcgg ttggcgaatg ctagggcaga ggaggagact      2160
     aaggcccagc gtagcgtttc ttgtggttta catgtgagtc agggtgtgta tctggattta      2220
     ggttggattc gtatcccaca attccttctg ctgggtgaaa cagctgttca aatgtgttca      2280
     gaacaggctt tagatacaca tcttgctgac tagctccagc tgtagcctga gcgaaatcct      2340
     cacgtctgac atctgtcttc ctgtttctga ctcattttag cccaaccaaa gtaagtctga      2400
     agtcgtgtga ggcttttaag tatctttacg tttcttcttt ttaaatgttt tggaaccttc      2460
     ggttttatta tttcatctga agctgatgta aatgttgtat ggctgttgtc agtggtgttt      2520
     attcataaca aaagcttcat gtgaggcggg aggagaaaag aacaatctag atgctgtctg      2580
     taatgcattt tcaaacactt tatagctgtc tgactaggaa atgtgtaacg tttcatttct      2640
     caactgccag atgttaaagc gattgaccta gaagatattt ttagttcatg atttttcaca      2700
     tttcaagact gaataatacc tcagtctcct tttgtatttt cttaagatgt tgtctctgga      2760
     agtctagttt agatatcgaa agatactttt tattttaaat ctgaaaatgt accaatattg      2820
     ggaagatttt gtatttctga ggtaaagtga agatgaaggg ctttttattt ttttgtacat      2880
     ttcttaagca agattttttg ttgaactggg aagccatgtc catgtagtga gttttaccag      2940
     ctgtagtaca aatatatgca atagttatga gttgaattaa aagaaaacgt ggacaccaaa      3000
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                            3040
//

If you have problems or comments...

PBIL Back to PBIL home page