(data stored in ACNUC8465 zone)

EMBL: BC056556

ID   BC056556; SV 1; linear; mRNA; STD; VRT; 2255 BP.
XX
AC   BC056556;
XX
DT   28-AUG-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Danio rerio ras homolog gene family, member Aa, mRNA (cDNA clone MGC:66058
DE   IMAGE:6795298), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2255
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2255
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (15-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a828efcca19dc86523da0a35489927d3.
DR   Ensembl-Gn; ENSDARG00000026845; danio_rerio.
DR   Ensembl-Tr; ENSDART00000040645; danio_rerio.
DR   Ensembl-Tr; ENSDART00000177931; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Leonard I. Zon, M.D.
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 121 Row: k Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 46329680.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2255
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZKid1"
FT                   /clone="MGC:66058 IMAGE:6795298"
FT                   /tissue_type="Kidney, zebrafish"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            1..2255
FT                   /gene="rhoaa"
FT                   /note="synonyms: zgc:85805, wu:fa66g04, wu:fb26g07,
FT                   fb26g07, fa66g04, Rhoa, zgc:66058"
FT   CDS_pept        56..637
FT                   /codon_start=1
FT                   /gene="rhoaa"
FT                   /product="ras homolog gene family, member Aa"
FT                   /db_xref="GOA:Q6NUX8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NUX8"
FT                   /db_xref="ZFIN:ZDB-GENE-040426-2150"
FT                   /protein_id="AAH56556.1"
FT                   /translation="MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD
FT                   IEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVK
FT                   HFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKT
FT                   KEGVREVFEMATRAALQAKKRGKKNACALL"
XX
SQ   Sequence 2255 BP; 745 A; 393 C; 471 G; 646 T; 0 other;
     ccttggggtc gtacaggaaa agataaagaa agcgaggaca tctgaaacga aaacgatggc        60
     tgcgattcgt aagaagcttg taatcgttgg agatggagcc tgtggaaaga cgtgtttact       120
     catcgttttc agtaaagacc agtttcctga ggtttacgtt cccacagtgt ttgagaacta       180
     tgtcgctgat attgaggtgg attcaaaaca ggtggaactg gctctatggg atacagctgg       240
     ccaagaggac tacgacaggc tgaggcccct gtcctaccca gacactgatg tcatccttat       300
     gtgcttttcc atagacagtc ctgacagttt ggagaacatc ccagagaaat ggacgccaga       360
     agtaaaacat ttctgcccta atgttccaat aatactggtg ggtaataaaa aagatttacg       420
     gaatgacgag cacactcgac gggagctgca gaagatgaaa caggaaccag ttaaaccaga       480
     ggagggacga gacatggcta atcgcatcaa tgccttcggc taccttgagt gttcagctaa       540
     aactaaggag ggcgtgaggg aagtgtttga aatggccaca agagcggcgc tccaagccaa       600
     gaaacgtggc aagaagaatg cctgcgcttt gctatagaga acacaagtgg aaaatgagaa       660
     gaacgaggga gggaaaaggg gtaaccaaac acggccaagg aaaatgaaag agctctaaaa       720
     gttcgcaaat agagggaaga aacagcccct agtgttaatt atgtactcgg gggttcaggg       780
     agggtcattt tcaatccagg ccaaaagaaa ctacagaaga tagtagggac agctgcaccg       840
     gcaaacaaaa gggacttaaa catttcacaa aaggccatca gtcctctttc aaatcaagat       900
     tagttgacct taaagccttc agactgattg atcacggagc aaggatagcg tatttgtaga       960
     gtaaagattg acgtgggttc acagtgattg cgttcgaggt gggattaaat gccatgtatt      1020
     ctttggcccc tttgattaga agatcagcac tgtaagcaag aacttggtct aaaaaaaata      1080
     gattcctttt ttggcagtaa atgcattatt cagggtgtaa aaggcattag ttactaccct      1140
     acatcgctta tgctacatgt caagcgggga gttgtttttt tggatcaaga cattggcgca      1200
     caatgtaata ctctagttga ctaccttaga aacctcccag gaacccagtg ccgtcttatg      1260
     taaaacattc atgactgatt ttctgatata tatacatttt tttcttgcat taacacgcta      1320
     atactgtttg ataacacaac tggttcctct gtgccctcct gtcctgtcgc agaatcgacg      1380
     gtttaatcgc tggtttaaag tagctgaaag tagtagtagt cttacaattc tttattccag      1440
     ttaagtatat cttgtacttt gttgccattt gcctataaaa ttctaagtaa gatgcattaa      1500
     gcaatgatca tactaattca cctttttgtg agtattttat gtgcttgctc atgtattgta      1560
     attaaaaaaa agaacaaaaa aacaaaaaca attttgggtt aatcagcctt cgtggagctc      1620
     caagcagaac tgcagctctg tatgttgact gtcagacact gtttgatttt ggctatatat      1680
     atatttatat atatagatac gtttttatca taggtgacag taatgtaatt taccccgtat      1740
     tactctttgc ctgcatgaca ggcttttatt tggtgtgcag aaatcaaata tatgtttatc      1800
     tcactgtata aatgagaagc tccctccatt ttcactccat gtctttttat tattcccctc      1860
     tttcttctcc agtactgtgc attttttatg tttttttgtt ttgtgaaatt ctactggctt      1920
     atactatatc atttttgcat attttacaaa ttctagtatc ttagaattga attaaagaag      1980
     gacaaaagat agtaaaaatg tgactgagag agagagagag ctgtttaatg ccatattatt      2040
     aaatgcaagt catttcttag aagagattct gcatttcatt gtaagagaaa aagcctttga      2100
     tgcgtcaatt atcttttgta taccagtgca tctttggatt tccacagact catttgaatt      2160
     gtactgaaaa aataaattct tatagggtaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2220
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                                 2255
//

If you have problems or comments...

PBIL Back to PBIL home page