(data stored in ACNUC9543 zone)

EMBL: BC056958

ID   BC056958; SV 1; linear; mRNA; STD; MUS; 525 BP.
XX
AC   BC056958;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus ribosomal protein L27a, mRNA (cDNA clone MGC:66730
DE   IMAGE:6817520), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-525
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-525
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bf2ee8065ed7a678dd59008e62939bc3.
DR   Ensembl-Gn; ENSMUSG00000046364; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031981; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000143107; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084463; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 126 Row: e Column: 14.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..525
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FV0"
FT                   /clone="MGC:66730 IMAGE:6817520"
FT                   /tissue_type="Brain, mouse, 13.5, 14.5, 16.5, 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..525
FT                   /gene="Rpl27a"
FT                   /note="synonym: L27A"
FT   CDS_pept        10..456
FT                   /codon_start=1
FT                   /gene="Rpl27a"
FT                   /product="ribosomal protein L27a"
FT                   /db_xref="GOA:P14115"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="MGI:MGI:1347076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14115"
FT                   /protein_id="AAH56958.1"
FT                   /translation="MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINF
FT                   DKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA"
FT   misc_difference 494..525
FT                   /gene="Rpl27a"
FT                   /note="polyA tail: 32 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 525 BP; 170 A; 125 C; 135 G; 95 T; 0 other;
     gccaccgcca tgccatccag actgaggaag acccggaaac tccggggcca cgtgagccac        60
     ggccacggcc gcatcggtaa gcaccgcaag cacccaggcg gccgcgggaa tgctggaggc       120
     atgcaccacc acaggatcaa ctttgacaaa tatcacccag gttactttgg gaaagttggt       180
     atgcggcatt accacttgaa gaggaaccag agcttctgcc caacagtcaa cctggataaa       240
     ctgtggacat tggtcagcga gcagacacgg gtcaatgcgg caaaaaacaa gactggagtt       300
     gctcccatca ttgatgttgt tcgatcaggc tactacaaag ttctgggcaa gggaaagctc       360
     cctaagcaac ctgtcatcgt gaaggccaaa ttcttcagca gaagagctga ggagaagatt       420
     aagggtgttg gaggtgcctg tgttctggtg gcttaaaagc cacaccggag gttaattaaa       480
     tgctaacatt ttcaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page