(data stored in ACNUC1829 zone)

EMBL: BC057419

ID   BC057419; SV 1; linear; mRNA; STD; VRT; 3857 BP.
XX
AC   BC057419;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Danio rerio CD81 antigen, mRNA (cDNA clone MGC:63937 IMAGE:6791130),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-3857
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3857
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d1a612533589deed796a5a58ed5de5bf.
DR   Ensembl-Gn; ENSDARG00000036080; danio_rerio.
DR   Ensembl-Tr; ENSDART00000052383; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Leonard I. Zon, M.D.
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 117 Row: d Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 41282104.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3857
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZKid1"
FT                   /clone="MGC:63937 IMAGE:6791130"
FT                   /tissue_type="Kidney, zebrafish"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            1..3857
FT                   /gene="cd81"
FT                   /note="synonyms: wu:fc07d07, fc07d07"
FT   CDS_pept        49..759
FT                   /codon_start=1
FT                   /gene="cd81"
FT                   /product="CD81 antigen"
FT                   /db_xref="GOA:Q6PFU1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PFU1"
FT                   /db_xref="ZFIN:ZDB-GENE-000831-5"
FT                   /protein_id="AAH57419.1"
FT                   /translation="MGVGVEGCTKCIKYMLFFFNFIFWLAGCVILGVSLWLRHDTKTSS
FT                   LLDLKYEGTESPTTFYISVYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFACLVLLF
FT                   ACEVAAGIWGFMNKDKISKEVIGFYDSVYDKGATYNTDNKNPATAVLKVFHETLQCCGK
FT                   GNLFTAIVDRWLTDTCPEHLRTNAVDCHTEIKNLFTDKISLIGIAALVVAVIMIFEMIF
FT                   SMVLCCGIRNSPVY"
XX
SQ   Sequence 3857 BP; 1108 A; 745 C; 748 G; 1256 T; 0 other;
     cacttcttca tcaaccggct ttaaaaacat ccttcagaaa ccgacaccat gggcgtgggc        60
     gtggaaggct gcacgaaatg catcaaatac atgctcttct tcttcaattt catcttctgg       120
     ctggctggtt gtgtaatctt gggggtttct ctctggctcc gtcatgacac taaaacgagc       180
     agtcttctgg acctgaagta tgagggaaca gaatcaccca ccactttcta catcagtgtc       240
     tacatcttga ttgccgtcgg cgctgtgatg atgtttgttg gatttcttgg atgctatgga       300
     gccattcagg agtcccagtg tcttcttgga accttctttg cctgcctggt ccttcttttt       360
     gcctgtgagg ttgccgctgg aatctgggga ttcatgaaca aagacaagat ctccaaagag       420
     gtaatcggtt tctatgactc tgtgtatgac aaaggcgcta cctacaacac tgacaacaag       480
     aatcctgcca ctgctgtcct aaaggtcttt catgagactc ttcagtgctg tggcaaagga       540
     aaccttttta cagccattgt tgataggtgg ctcactgaca cctgtcctga acatttaaga       600
     acaaatgctg tggactgtca caccgagatc aagaatcttt tcactgacaa gatcagcctg       660
     atcggcatcg ctgccctggt tgttgctgta atcatgatct tcgagatgat cttcagcatg       720
     gtgctttgct gcggcatcag gaacagccct gtgtattaaa acaagggcaa gatatgacct       780
     ttaaaacatc agccaaaaaa aatcgttttg ttttatatct accatctcct attttgtttt       840
     gtatctccca ttgtttccta atgtagtcgc tctgtccaat tcctgaagtc gcagatcaac       900
     ttttgtgcat tttatttgtc gaaaagtggc ggtggaacca ccaacaacta gtctgctatc       960
     gtttacgctg tagttggtga tggctagctt tagcagtaga cttataaaca cacagagtac      1020
     attatcacat gaaggatgga tacatttatt tgcttgtagt ttctttttgt gtgttttaac      1080
     tgttaagtac cgctattgct ttggggttac tattattctt ttttcgtatg tataaactgt      1140
     atatatttgc aggcctgtac ggctcttagc atgaacctca tactgaacac tcttttccat      1200
     cttcctctct gtttgtatgt actcgactct tcctgagaaa ccactaaata aacagtgtta      1260
     gttaggtgag agtaagctag aatacggtgc ttttttgttg gaaatgagag tacaaggatt      1320
     aaaatgtttg aaggcccagg tatatgtaat ttcctgagtt cagtcttccg cattgttgaa      1380
     ggacacttca ttatgagcaa gcagataaac gcattcggct tgtgcgacca acctagtgga      1440
     ccactggttt caagtgttca aatcactccc acagtagcac aattggcctg tgcacatgct      1500
     gtccatgagg ctgaactgga cgtgggcaag ggaagtatac tttccgctca gtttggccaa      1560
     atcccagttg acacccctga tggcaacagc cgttttaagt gcacaagacc acaagtgtag      1620
     atgaagtgtg ccatttgaga ttgggccttt atagaagttg atgagcactg tgttgtttgc      1680
     tttttgcacc attcctcttt cagtagagct cagtgagggc aaatctttat gatataatga      1740
     gtagtagtgt aagtcagtgg ctttttgtga cataatattg atcaattttg cctgttttaa      1800
     ttttttttcc aaacagttcg gactgaaata cttttttaaa gtataaaaat atatacagta      1860
     taatattgaa gttggtggtt aacatttatt ttttaaatgc atgttaatat tgttacatag      1920
     aaagctatac atttgcaaag ttatactcga ctttagtcta aaaccttaca ataaacatca      1980
     aaattattac tcatatatgc tttggagtaa tatgctttaa tagtatttaa tgtaagtact      2040
     ttcaagtgtg tattttgttt ttattttagg tgcctcattg gtaaagaatc caaattagtt      2100
     gtttgtttgt tcaacattat gccacaagcg ctgtctgata agcgttgaac ctggaatttt      2160
     ccttttaaag gtgctgatct ttcatcattc agtgaattcg gagctgtgtt cttccttact      2220
     aatcttacca tttctgccat ttaaagacag gcaataatat taaagggata attccctcaa      2280
     atattaaatc caccatcatt taatcagcct tggcttgttg aaaacctatt caggtttctt      2340
     ctgttgaaca caaaagaagt tactttgaaa aacaccaaat tgacaaccat ggtaattttt      2400
     attatatgga agttaatggg tgcccagtaa gtgtaacaga ggccagctag ttaagggctg      2460
     tgcaggtaaa cctcactcct cttaacctct aaagttgttc tagcgacaga ggccatggtc      2520
     tttagcctcc ttgttagagc aaccgacttc catgcggaga gttgccaatg tttgatccca      2580
     gctcggagaa ggttaagctc tgtaggaccg acggggttat ataagcatca gtcttcacaa      2640
     taatatcttt agtgttccac agaggaaact tacaaaggtt tacaaccaca taagaagtaa      2700
     actatgaggt aattttcatt ttgaattcag aaagtgtgtt tcttatatgt atgtgagacc      2760
     acataggtga gagagagctg ataaatatct acaacctcct gatgctgatt aagctcaata      2820
     tacagtgatg taatgtgttt ttctgcatgt ccgttataca aggtgttgga cttatgtact      2880
     gccccggtca ctaaagttct gcccctcgtt acagtaagcc aagccataga gaggattcat      2940
     acatacagta cctactagcc ttataacatg agacacccta tcccttaatc acttagatag      3000
     caaatccagg tcgattctga tggaatcgtc tatgctgtca ttgctgttat gtgctacaaa      3060
     atcactagac tagaaaaccc aaggatgttt gtgtgaatgt acacgtgtga tatctgttga      3120
     cggtgagctc agaaggataa actctgttgt tgatacgata gacaagctct ttactcttca      3180
     ctgccacctc tatcacagat gtagagtctg taataccatg ccatactcgc taggtggcgt      3240
     tcaaatacta ttcaactggt gtctacgcca tttcttaagc ctgtgtacat gattttcgtg      3300
     cacttcttct atctagacct cactattagg acgcgcccca tccttgatga attaatacca      3360
     tcagatttgt gattttacta catgcattat gcaaccttgt cttgttaaca cattttgcct      3420
     atgctgatat gcttcaaagt gtcttgtaat atgtacagct atatagtata ctaattacca      3480
     tgtaaagaca atgtatgcct ttaattgtga taactttttc tggtacttgt caaaaaaaaa      3540
     aaaaaatgaa gaacctcaga aatgaagcat gtaagaattg tacggggtcc tgacaggtta      3600
     agcatgatct ctatctaatt aataacatga aggaaaatct aaattaaaac agtatccagg      3660
     tatttgatca tgtttttaaa tatagcattt gtgttgaaag gatctcgtat tatttgatac      3720
     ccaattggaa agcttgaaca tgaatctctt taccaattat acctattata cattttggtc      3780
     tgattttgtt gcccaaatat gtaggaatta aatgtatttt acaaataaaa aaaaaaaaaa      3840
     aaaaaaaaaa aaaaaaa                                                     3857
//

If you have problems or comments...

PBIL Back to PBIL home page